Detailed information of component protein


Summary

Component ID T6CP011978
Component protein type PAAR
T6SS ID (Type) T6SS00540 experimental (Type i3)
Strain Pseudomonas fluorescens F113
Replicon chromosome
Sequence Protein sequence (1480 a.a.); Nucleotide sequence (4440 bp)
Reference
[1] Barret M, Egan F, Fargier E, et al. Genomic analysis of the type VI secretion systems in Pseudomonas spp.: novel clusters and putative effectors uncovered. Microbiology (Reading). 2011 Jun;157(Pt 6):1726-1739. doi: 10.1099/mic.0.048645-0. Epub 2011 Apr 7. PMID: 21474537
[2] Redondo-Nieto M, Barret M, Morrissey J, et al. Genome sequence reveals that Pseudomonas fluorescens F113 possesses a large and diverse array of systems for rhizosphere function and host interaction. BMC Genomics. 2013 Jan 25;14:54. doi: 10.1186/1471-2164-14-54. PMID: 23350846
[3] DurĂ¡n D, Bernal P, Vazquez-Arias D, et al. Pseudomonas fluorescens F113 type VI secretion systems mediate bacterial killing and adaption to the rhizosphere microbiome. Sci Rep. 2021 Mar 11;11(1):5772. doi: 10.1038/s41598-021-85218-1. PMID: 33707614
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) PSF113_RS59875
Coordinate (Strand) 6694475..6698914 (+)
NCBI ID WP_014340893.1
RefSeq NC_016830
Uniprot ID G8Q727_PSEO1, A0A2M8STM1_9PSED
KEGG ID pfe:PSF113_5809
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
DUF6531 PF20148.1 8.8e-23 295..374
RHS PF03527.16 3.9e-14 1227..1263
RES PF08808.13 1.1e-11 1366..1476
PAAR_motif PF05488.15 1.2e-08 173..217
RHS_repeat PF05593.16 5.8e-07 730..764
RHS_repeat PF05593.16 1.8e-06 650..678
RHS_repeat PF05593.16 4.1e-05 794..826

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-22 MSDALWAARLGDALNHTSMMAD
Transmembrane helix 23-45 ILGGVLEVAANIAITAVATAAVV
Inside 46-51 AATGIT
Transmembrane helix 52-74 VATGGLGCFLLGAVVGAVVGLAM
Outside 75-1479 SKTGADKGLSDICEGIGNALFPPTVQANILTGSTDTLTNNIPAARAAGAIESHVAPAGTELEAPEAEPSYLDMAENFFSQMWRPTVAVPAPGAVPKPLDMIICMKHPPMPPQFLAEGSDKVTINGQPAVRSGDRSTCDATVVSAGLISPDVTIGGGSVVVREIRSGKTPGVGLAVTALLMLKGGKGKFLSNLPCMLVGGAASMAVSSAMGAAANAAMGSSNPVHAATGAKVLGDVEEMDFVLPGILPIDWQRFYNSRDERRDGLFGAGWSVPYEVRVEILPHPDGGETLVYSDEQGRRIDMGSIPLGGAVFSAGEGLSVRRHANGELLIESADGLYRLFEPTPANAALLRLNQLGDRNDNRIYLDYDDNGRLAQLRDTFDLTRIALAYDERWPQRVSRIDRLYADQRREVLMHYGYDGQGDLAQVRQSNDQVKRRYAYDAGRRMVEHQLPTGLRCFYEWALVENLEWRVVRHWTDAGDAYTFDYDLAAGTTRITDGLQRISTRRWDTRYQITETTDPLDRTWTFQWNDESQLLGATDPNGGQHQFSYDEAGNLCETRDPLGRSESTLWLEHWALPLAETDAAGNTWQYRYDARGNRIRETDPLGHVTRYRHDAHGQVVEVIDATGKSKTMRWTALGQLSEHTDCSGYTTRLSYCERGLLLSSTDALGERTLFSYDDQGRLLSKQLPDGRTEHYQRDASGQLIGYSDPAGHTTNFQHTLSGQLRVRTDAHGRRVELSYDNYGRLLALTNENGERYRFAWDAADRLTAQHSLDGSLKRYAYDPLDNVTRVEALAVPGSTDLDLSPQAPIIHELERDAMGRLVAKVTADGRTEYRYDALDQVNAITFTSQTGEVQSLGLRYDALGQLITEQGWAGNLEHRYDELGNLTQTLLPDGRWLNRLHYGSGHLHQINLDGQVISDFERDRLHREVLRTQGRQSTRSEYDRSGRLRARQRRQQGQSTLLPPVAQSLFGYDASDQRVERFDSQPEASHRQLLHYDATGRILASQDNLQGQRESFAYDPAANLLDGLGTGQVAHNRLLTYQDKRYRYDGFGRMVEKRSARRGVQRFRYDAEQRLVEVRNDNGSVVKMTYDPLGRRIEKAEYDRHATLLNRTRFTWDALQLLQEHRDSQTSLYIYADDSHEPLARVDGLGEQQKVRYYHNDLNGLPEQLSEADGHTLWRARYQVWGNTAEELREPYYIEEQNLRFQGQYLDRETGLHYNTLRFYDPDIGRFTTPDPIGLAGGLNLYQYAPNPVSWIDPFGLMKCSTPPKGRKVNRTVYRFEEPGRISTTWTAHKWNVASRHRYTAPGLGGVYGANSRKTAMGEVNHWGVDLSTRVLVSKKVQLNNVLDLTRADVRKQLGVSLKSITGDKYTQTHQIGAWAKANGYDGILAPSARNPTGSNLISFAGF



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9740 - -



  Protein sequence: 1480 a.a.    

>T6CP011978 NC_016830:6694475-6698914 [Pseudomonas fluorescens F113] [PAAR]
MSDALWAARLGDALNHTSMMADILGGVLEVAANIAITAVATAAVVAATGITVATGGLGCFLLGAVVGAVVGLAMSKTGAD
KGLSDICEGIGNALFPPTVQANILTGSTDTLTNNIPAARAAGAIESHVAPAGTELEAPEAEPSYLDMAENFFSQMWRPTV
AVPAPGAVPKPLDMIICMKHPPMPPQFLAEGSDKVTINGQPAVRSGDRSTCDATVVSAGLISPDVTIGGGSVVVREIRSG
KTPGVGLAVTALLMLKGGKGKFLSNLPCMLVGGAASMAVSSAMGAAANAAMGSSNPVHAATGAKVLGDVEEMDFVLPGIL
PIDWQRFYNSRDERRDGLFGAGWSVPYEVRVEILPHPDGGETLVYSDEQGRRIDMGSIPLGGAVFSAGEGLSVRRHANGE
LLIESADGLYRLFEPTPANAALLRLNQLGDRNDNRIYLDYDDNGRLAQLRDTFDLTRIALAYDERWPQRVSRIDRLYADQ
RREVLMHYGYDGQGDLAQVRQSNDQVKRRYAYDAGRRMVEHQLPTGLRCFYEWALVENLEWRVVRHWTDAGDAYTFDYDL
AAGTTRITDGLQRISTRRWDTRYQITETTDPLDRTWTFQWNDESQLLGATDPNGGQHQFSYDEAGNLCETRDPLGRSEST
LWLEHWALPLAETDAAGNTWQYRYDARGNRIRETDPLGHVTRYRHDAHGQVVEVIDATGKSKTMRWTALGQLSEHTDCSG
YTTRLSYCERGLLLSSTDALGERTLFSYDDQGRLLSKQLPDGRTEHYQRDASGQLIGYSDPAGHTTNFQHTLSGQLRVRT
DAHGRRVELSYDNYGRLLALTNENGERYRFAWDAADRLTAQHSLDGSLKRYAYDPLDNVTRVEALAVPGSTDLDLSPQAP
IIHELERDAMGRLVAKVTADGRTEYRYDALDQVNAITFTSQTGEVQSLGLRYDALGQLITEQGWAGNLEHRYDELGNLTQ
TLLPDGRWLNRLHYGSGHLHQINLDGQVISDFERDRLHREVLRTQGRQSTRSEYDRSGRLRARQRRQQGQSTLLPPVAQS
LFGYDASDQRVERFDSQPEASHRQLLHYDATGRILASQDNLQGQRESFAYDPAANLLDGLGTGQVAHNRLLTYQDKRYRY
DGFGRMVEKRSARRGVQRFRYDAEQRLVEVRNDNGSVVKMTYDPLGRRIEKAEYDRHATLLNRTRFTWDALQLLQEHRDS
QTSLYIYADDSHEPLARVDGLGEQQKVRYYHNDLNGLPEQLSEADGHTLWRARYQVWGNTAEELREPYYIEEQNLRFQGQ
YLDRETGLHYNTLRFYDPDIGRFTTPDPIGLAGGLNLYQYAPNPVSWIDPFGLMKCSTPPKGRKVNRTVYRFEEPGRIST
TWTAHKWNVASRHRYTAPGLGGVYGANSRKTAMGEVNHWGVDLSTRVLVSKKVQLNNVLDLTRADVRKQLGVSLKSITGD
KYTQTHQIGAWAKANGYDGILAPSARNPTGSNLISFAGF*

  Nucleotide sequence: 4440 bp    

>T6CP011978 NC_016830:6694475-6698914 [Pseudomonas fluorescens F113] [PAAR]
ATGTCTGACGCACTCTGGGCCGCTCGGCTAGGCGACGCGCTGAACCACACCTCGATGATGGCCGATATCCTCGGCGGCGT
CCTGGAAGTAGCCGCGAACATTGCGATCACCGCGGTAGCGACGGCTGCCGTGGTAGCGGCCACGGGCATTACCGTTGCCA
CTGGCGGCTTGGGTTGCTTCCTACTCGGCGCGGTGGTGGGCGCCGTGGTCGGCCTCGCCATGAGCAAGACCGGGGCCGAC
AAGGGGCTAAGCGACATATGCGAGGGCATCGGCAACGCCCTCTTCCCGCCCACGGTGCAGGCCAACATCCTCACCGGCTC
CACCGACACCTTGACCAACAACATCCCTGCCGCCCGCGCCGCCGGAGCGATCGAGTCCCATGTCGCGCCGGCCGGCACCG
AACTTGAAGCACCCGAAGCCGAACCCAGCTACCTGGACATGGCCGAGAATTTCTTCTCACAGATGTGGCGTCCCACCGTC
GCCGTGCCCGCGCCCGGTGCCGTGCCCAAGCCGCTGGACATGATCATCTGCATGAAACACCCGCCGATGCCGCCGCAATT
CCTGGCCGAAGGCTCGGACAAAGTCACCATCAACGGTCAGCCCGCGGTGCGCAGCGGCGACCGCAGCACCTGCGATGCGA
CCGTGGTGTCGGCCGGGCTGATTTCCCCTGACGTGACCATTGGCGGCGGTTCGGTGGTGGTGCGCGAGATCCGCAGCGGC
AAGACCCCGGGCGTCGGGCTGGCGGTCACGGCGCTGCTGATGCTAAAGGGCGGCAAGGGTAAATTCCTCAGTAACCTGCC
GTGCATGTTGGTCGGCGGTGCGGCGTCGATGGCGGTCAGTAGCGCGATGGGCGCCGCGGCCAACGCCGCGATGGGCTCCT
CAAACCCCGTGCACGCCGCCACCGGGGCCAAAGTGTTGGGCGATGTCGAGGAGATGGACTTCGTCCTGCCCGGCATCTTG
CCGATCGACTGGCAACGCTTCTACAACAGCCGCGACGAACGCCGCGACGGGTTGTTCGGTGCCGGTTGGAGCGTGCCCTA
TGAGGTGCGCGTCGAAATCCTGCCCCATCCAGACGGCGGCGAAACCCTGGTTTATAGCGACGAACAGGGCCGACGCATCG
ACATGGGTTCCATCCCGTTGGGCGGCGCCGTGTTCAGTGCCGGTGAAGGCCTCAGCGTGCGACGGCATGCCAACGGCGAG
CTGCTGATAGAGAGCGCGGACGGACTGTACCGCTTGTTCGAACCCACGCCAGCCAATGCAGCGCTGCTACGCCTGAACCA
ACTGGGTGACCGCAACGACAACCGTATCTACCTGGACTACGACGACAACGGACGCCTGGCGCAACTGCGTGACACCTTCG
ACCTGACCCGCATCGCACTGGCGTATGACGAGCGCTGGCCACAACGAGTCAGCCGGATCGACCGCCTCTATGCCGATCAA
CGCCGGGAAGTGCTGATGCACTATGGCTACGACGGCCAGGGCGATCTGGCGCAGGTCCGTCAGTCCAACGACCAGGTAAA
ACGTCGCTACGCCTACGACGCCGGGCGGCGAATGGTGGAACACCAACTGCCTACCGGGCTTCGCTGTTTCTATGAATGGG
CGTTGGTTGAAAACCTGGAATGGCGCGTGGTTCGCCACTGGACCGACGCGGGCGACGCCTACACCTTCGATTACGACCTG
GCCGCCGGGACCACGCGCATCACCGACGGCTTGCAGCGCATCAGCACCCGTCGCTGGGATACCCGCTATCAGATCACCGA
AACCACCGACCCGTTGGATCGCACCTGGACCTTCCAGTGGAACGACGAAAGCCAGTTGCTGGGGGCGACCGATCCCAACG
GCGGACAACATCAGTTCAGCTATGACGAAGCCGGGAACCTCTGCGAAACCCGCGACCCGCTGGGGCGCAGCGAGTCAACC
CTGTGGCTCGAACACTGGGCCCTGCCCCTGGCTGAAACCGATGCCGCGGGAAATACCTGGCAGTACCGCTATGACGCGCG
GGGCAACCGCATTCGCGAAACCGACCCGCTGGGCCACGTCACCCGCTATCGCCACGACGCCCACGGCCAAGTGGTGGAGG
TCATCGACGCCACCGGCAAAAGCAAGACCATGCGCTGGACGGCCCTTGGGCAACTGAGCGAACACACCGATTGTTCCGGT
TACACCACACGGTTGAGCTATTGCGAGCGCGGGCTGTTGCTCAGCAGCACCGACGCACTGGGAGAGCGGACGCTTTTCAG
CTACGACGACCAGGGTCGGCTGCTGAGCAAGCAACTGCCGGACGGGCGCACCGAGCACTATCAGCGTGACGCTAGCGGAC
AGTTGATCGGCTATAGCGACCCGGCTGGACACACGACAAATTTCCAACACACCCTAAGCGGTCAACTGCGGGTACGCACC
GACGCCCATGGCCGCCGGGTAGAGCTGAGCTACGACAACTACGGGCGCCTGCTGGCCCTGACCAATGAAAACGGTGAGCG
CTACCGGTTTGCCTGGGACGCCGCCGACCGCTTGACCGCCCAGCACAGCCTGGACGGCAGCCTCAAGCGCTACGCCTACG
ACCCGCTGGACAACGTCACCCGCGTGGAAGCGCTCGCGGTGCCCGGCAGCACCGACCTGGACCTCTCGCCCCAAGCCCCC
ATCATTCATGAGCTGGAGCGCGATGCGATGGGGCGACTGGTGGCGAAAGTCACCGCAGACGGGCGCACCGAGTACCGCTA
TGACGCGCTCGACCAGGTCAACGCGATCACCTTCACCAGCCAGACCGGTGAAGTACAAAGCCTGGGCTTGCGTTACGACG
CCCTGGGGCAATTGATTACCGAGCAAGGCTGGGCGGGGAACCTCGAACATCGCTATGACGAACTGGGCAACCTGACCCAG
ACGCTGCTTCCCGACGGTCGTTGGCTGAACCGCCTGCACTACGGCAGCGGTCACCTGCACCAGATCAACCTCGACGGCCA
GGTCATCAGCGATTTCGAACGCGACCGCCTGCACCGCGAAGTGCTGCGCACCCAGGGGCGCCAGAGCACCCGCAGCGAAT
ACGACCGCAGTGGCCGCCTGCGGGCCCGTCAGCGGCGGCAACAGGGTCAGTCCACGCTGCTGCCGCCCGTGGCGCAATCA
CTGTTTGGTTATGACGCCAGCGATCAGCGAGTGGAGCGCTTCGACAGCCAGCCCGAAGCGTCCCATCGCCAATTGCTGCA
CTATGACGCCACCGGCCGCATCCTCGCCAGCCAGGACAACCTTCAAGGCCAGCGTGAAAGCTTCGCCTATGACCCGGCCG
CCAACCTGCTGGACGGTCTGGGCACAGGCCAGGTCGCGCATAACCGCTTGTTGACCTACCAGGACAAGCGCTACCGCTAT
GACGGTTTCGGTCGCATGGTGGAAAAACGCAGCGCCCGCCGTGGCGTCCAGCGTTTTCGCTACGATGCTGAACAACGCCT
GGTGGAAGTGCGCAACGATAACGGCTCCGTCGTAAAAATGACCTATGACCCGTTGGGTCGACGTATCGAAAAAGCCGAGT
ACGACCGCCACGCCACGCTGCTCAACCGCACCCGTTTCACCTGGGATGCGCTGCAACTTTTGCAGGAACACCGCGACAGC
CAGACCAGCCTCTACATCTACGCCGACGACAGCCACGAACCCCTGGCGAGGGTCGACGGCCTGGGCGAGCAACAGAAGGT
CCGTTATTACCACAACGACCTCAACGGCCTGCCCGAACAGCTCTCGGAAGCCGACGGCCACACACTCTGGCGAGCCCGTT
ACCAAGTGTGGGGCAACACCGCCGAAGAGCTGCGCGAACCGTATTACATCGAAGAGCAGAACCTGCGCTTCCAGGGCCAA
TACCTGGACCGCGAAACCGGGCTGCACTACAACACCCTGCGTTTCTACGACCCGGACATCGGCCGCTTCACCACACCGGA
CCCGATCGGCTTAGCCGGTGGGCTGAACCTCTACCAGTACGCGCCGAACCCGGTGAGTTGGATCGACCCCTTCGGGCTGA
TGAAATGCTCGACGCCGCCCAAGGGTCGCAAGGTCAACCGAACGGTGTATCGCTTTGAAGAGCCGGGGCGGATCAGCACG
ACTTGGACCGCGCACAAGTGGAACGTCGCCTCCAGGCACCGTTACACCGCCCCCGGCCTGGGCGGTGTCTATGGCGCCAA
CTCACGCAAGACAGCCATGGGCGAAGTCAATCACTGGGGCGTGGACCTGTCCACACGGGTACTGGTCAGCAAGAAAGTGC
AGCTCAACAACGTCCTGGACCTGACCCGGGCCGATGTGCGCAAACAATTGGGGGTCTCCCTCAAGAGCATTACCGGCGAC
AAGTACACCCAGACCCATCAAATCGGCGCCTGGGCCAAGGCTAATGGTTATGATGGGATCCTGGCGCCGTCGGCGCGAAA
CCCGACCGGCAGCAACTTGATTTCCTTTGCAGGTTTTTAG