Detailed information of component protein


Summary

Component ID T6CP009583
Component protein type TssD
T6SS ID (Type) T6SS00015 experimental (Type i1)
Strain Pseudomonas putida KT2440
Replicon chromosome
Sequence Protein sequence (172 a.a.); Nucleotide sequence (516 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) PP_RS21195
Coordinate (Strand) 4610523..4611038 (+)
NCBI ID WP_010954872.1
RefSeq NC_002947
Uniprot ID A0A173HHY9_9PSED, Q88FK8_PSEPK, A0A1X0ZLM9_PSEPU, A0A2N1IN84_9PSED
KEGG ID ppu:PP_4082
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 2.2e-36 18..155

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-171 MPTPAYIKIVGQTQGNITAGAFTADSVGNVFQQGHEDQILVQEIKHEVTTPTDPQSGQPSGQRVHKPFIFTSSLNKATPLMYQALATGEMLPTVEVSWYRTSSEGKQEHFFTTTLEDATIVSINTVLPHALDKDNENYTQLVEVSLAYRKITWAHDVANTEGSDDWRAPAA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9211 - -



  Protein sequence: 172 a.a.    

>T6CP009583 NC_002947:4610523-4611038 [Pseudomonas putida KT2440] [TssD]
MPTPAYIKIVGQTQGNITAGAFTADSVGNVFQQGHEDQILVQEIKHEVTTPTDPQSGQPSGQRVHKPFIFTSSLNKATPL
MYQALATGEMLPTVEVSWYRTSSEGKQEHFFTTTLEDATIVSINTVLPHALDKDNENYTQLVEVSLAYRKITWAHDVANT
EGSDDWRAPAA*

  Nucleotide sequence: 516 bp    

>T6CP009583 NC_002947:4610523-4611038 [Pseudomonas putida KT2440] [TssD]
ATGCCAACACCCGCTTACATCAAGATCGTAGGCCAGACCCAAGGCAACATCACCGCTGGCGCCTTCACCGCTGACTCCGT
CGGCAACGTGTTCCAACAAGGCCATGAAGATCAGATTCTGGTTCAGGAAATCAAGCATGAGGTGACTACGCCCACTGACC
CCCAGAGCGGTCAACCGAGTGGCCAGCGCGTGCATAAGCCTTTCATATTCACCAGTTCACTGAACAAAGCTACCCCCCTG
ATGTATCAGGCACTTGCCACCGGCGAAATGCTGCCAACAGTCGAGGTCAGCTGGTATCGCACCTCCTCGGAAGGCAAACA
AGAGCATTTTTTCACCACCACGCTCGAAGACGCCACCATCGTCAGCATCAATACCGTGCTTCCCCACGCACTCGACAAAG
ACAATGAAAACTACACCCAGCTGGTTGAAGTATCGCTGGCGTATCGAAAGATCACGTGGGCTCACGATGTAGCCAATACC
GAAGGCTCTGACGACTGGCGCGCACCCGCCGCCTGA