Detailed information of component protein


Summary

Component ID T6CP009581
Component protein type TssL
T6SS ID (Type) T6SS00014 experimental (Type i4b)
Strain Pseudomonas putida KT2440
Replicon chromosome
Sequence Protein sequence (239 a.a.); Nucleotide sequence (717 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) PP_RS16015
Coordinate (Strand) 3485954..3486670 (-)
NCBI ID WP_010953990.1
RefSeq NC_002947
Uniprot ID A0A2V4FB89_9PSED, Q88IA7_PSEPK
KEGG ID ppu:PP_3092
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
DotU PF09850.11 5.4e-53 20..219

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Inside 1-198 MTEAVLQQGAVPAASDKPTLKDLVQDFISMALIVRRGRQVTSVQAFEGSVERFFANLERDARAANYSVEQVKDTQYALCAFLDESVLRSDDNALRRHFELQPLQFRYFGVHLAGEGFFEKVDALRADVKQNIDVLEVYHLCLALGFEGKFSLGQKDQLRYLANTLGQDIARYRKAPKALSPDWALPDQVSQMLRHEVP
Transmembrane helix 199-221 LWVYLALIALVCVAVYLTLDWLL
Outside 222-238 GKDVAALSEQIRQLFSA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9805 - -



  Protein sequence: 239 a.a.    

>T6CP009581 NC_002947:c3486670-3485954 [Pseudomonas putida KT2440] [TssL]
MTEAVLQQGAVPAASDKPTLKDLVQDFISMALIVRRGRQVTSVQAFEGSVERFFANLERDARAANYSVEQVKDTQYALCA
FLDESVLRSDDNALRRHFELQPLQFRYFGVHLAGEGFFEKVDALRADVKQNIDVLEVYHLCLALGFEGKFSLGQKDQLRY
LANTLGQDIARYRKAPKALSPDWALPDQVSQMLRHEVPLWVYLALIALVCVAVYLTLDWLLGKDVAALSEQIRQLFSA*

  Nucleotide sequence: 717 bp    

>T6CP009581 NC_002947:c3486670-3485954 [Pseudomonas putida KT2440] [TssL]
ATGACCGAAGCCGTACTGCAACAGGGCGCCGTCCCGGCCGCCAGCGACAAACCGACGCTCAAGGACCTGGTCCAGGACTT
CATCAGCATGGCGTTGATCGTACGTCGCGGCCGCCAGGTCACCTCGGTGCAGGCCTTCGAAGGTAGCGTCGAACGCTTCT
TCGCCAACCTGGAACGTGATGCCCGTGCCGCCAACTACAGCGTCGAGCAGGTCAAGGACACCCAATACGCGTTGTGCGCC
TTCCTCGACGAAAGCGTCCTGCGCTCGGACGACAATGCGCTGCGTCGGCACTTTGAGCTGCAGCCGTTGCAGTTCCGCTA
TTTCGGCGTGCACCTGGCCGGCGAAGGCTTCTTCGAGAAGGTCGATGCGCTGCGCGCCGACGTCAAGCAGAACATCGACG
TGCTCGAGGTTTACCACCTGTGCCTGGCACTGGGCTTCGAGGGCAAGTTCAGCCTCGGCCAAAAGGACCAGCTGCGTTAC
CTGGCCAATACACTGGGCCAGGATATCGCCCGCTACCGCAAGGCGCCCAAAGCCCTGTCACCGGACTGGGCACTGCCCGA
CCAGGTGTCGCAGATGCTGCGCCATGAAGTACCGCTGTGGGTGTATCTGGCGCTTATCGCGTTGGTCTGCGTCGCCGTGT
ACCTGACGCTGGACTGGTTGCTTGGCAAGGACGTCGCCGCCCTGTCCGAACAAATCCGCCAGCTGTTCAGTGCCTGA