Detailed information of component protein


Summary

Component ID T6CP009578
Component protein type TssA
T6SS ID (Type) T6SS00014 experimental (Type i4b)
Strain Pseudomonas putida KT2440
Replicon chromosome
Sequence Protein sequence (362 a.a.); Nucleotide sequence (1086 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) PP_RS15990
Coordinate (Strand) 3476880..3477965 (-)
NCBI ID WP_010953986.1
RefSeq NC_002947
Uniprot ID A0A2V4FG87_9PSED, Q88IB1_PSEPK
KEGG ID ppu:PP_3088
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
ImpA_N PF06812.14 1.3e-30 19..133

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-361 MPEILNDLSLATLVAPIEGGSGEDLSFSALFDQIKEARRADPDYLTQGDWQTDLKTADWEQVINLSAQGLAQQSKDLMLVAWLCEGLAQREHFEGITFGLELTEQLLVAFWETLYPTLEDGLDERAARLSWLKTTLTDIAGGLPIIQGQNFGVLRYDESRHVENLALQNPKAMQTALNEGKINAEIFQRSVALTDTDYLRAKAQQIATSLNACKRLQASADRLFGHEAPSFASLADMLSRASQLAEKLLKDRGVELHPAIPEEAQPQAMAANLHEAGEPMNATPPTTAPAALRTTPLTRDEAFTMLAGIAQYFKQSEPQSPVPYLIERAIKWGNMPLEGWLSDVIKDNNVVDNIRDVLGTR



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9819 - -



  Protein sequence: 362 a.a.    

>T6CP009578 NC_002947:c3477965-3476880 [Pseudomonas putida KT2440] [TssA]
MPEILNDLSLATLVAPIEGGSGEDLSFSALFDQIKEARRADPDYLTQGDWQTDLKTADWEQVINLSAQGLAQQSKDLMLV
AWLCEGLAQREHFEGITFGLELTEQLLVAFWETLYPTLEDGLDERAARLSWLKTTLTDIAGGLPIIQGQNFGVLRYDESR
HVENLALQNPKAMQTALNEGKINAEIFQRSVALTDTDYLRAKAQQIATSLNACKRLQASADRLFGHEAPSFASLADMLSR
ASQLAEKLLKDRGVELHPAIPEEAQPQAMAANLHEAGEPMNATPPTTAPAALRTTPLTRDEAFTMLAGIAQYFKQSEPQS
PVPYLIERAIKWGNMPLEGWLSDVIKDNNVVDNIRDVLGTR*

  Nucleotide sequence: 1086 bp    

>T6CP009578 NC_002947:c3477965-3476880 [Pseudomonas putida KT2440] [TssA]
ATGCCTGAAATTCTCAATGACCTCTCGCTGGCCACACTGGTCGCCCCTATCGAGGGTGGCAGTGGCGAAGACTTGAGCTT
CTCTGCCTTGTTCGATCAGATCAAGGAGGCACGCCGGGCGGACCCTGACTACCTGACCCAGGGCGACTGGCAAACCGACT
TGAAGACTGCCGACTGGGAGCAGGTGATCAACCTGTCGGCTCAAGGGCTTGCGCAGCAAAGCAAAGACCTGATGCTGGTG
GCCTGGCTCTGCGAGGGGCTGGCCCAGCGTGAACACTTCGAAGGCATCACCTTTGGCCTCGAGCTGACCGAACAGCTCCT
GGTTGCGTTCTGGGAAACACTGTACCCCACCCTCGAAGACGGCCTGGACGAGCGCGCGGCGCGACTGTCCTGGCTGAAGA
CCACGCTCACCGACATTGCCGGTGGCTTGCCCATTATCCAGGGGCAGAATTTTGGCGTGTTGCGCTATGACGAATCACGC
CATGTAGAGAACCTCGCCTTGCAAAACCCCAAGGCGATGCAGACAGCACTGAACGAAGGCAAGATCAACGCCGAGATCTT
CCAGCGCTCGGTAGCGCTTACCGACACCGATTACCTGCGCGCCAAGGCGCAGCAGATCGCTACCAGCCTGAATGCATGCA
AACGCCTGCAGGCCAGCGCCGACCGCCTGTTCGGCCACGAGGCGCCCAGCTTTGCCAGCCTTGCCGACATGCTTTCGCGT
GCCAGCCAGCTGGCGGAAAAACTGCTCAAGGACCGCGGCGTAGAGCTACACCCCGCCATCCCGGAAGAAGCACAGCCACA
GGCCATGGCTGCCAACCTCCACGAAGCAGGTGAGCCGATGAATGCCACGCCCCCGACGACCGCGCCTGCAGCCCTGCGCA
CCACCCCGCTGACCCGCGACGAGGCATTCACCATGCTTGCGGGCATCGCCCAGTACTTCAAACAGAGCGAACCGCAAAGC
CCGGTACCCTACCTGATCGAACGTGCGATCAAGTGGGGCAACATGCCGTTGGAAGGCTGGTTGAGTGACGTGATCAAGGA
CAACAATGTGGTGGACAACATCCGCGATGTGCTGGGCACCCGCTAG