Detailed information of component protein


Summary

Component ID T6CP008458
Component protein type TssE
T6SS ID (Type) T6SS00040 experimental (Type i1)
Strain Pectobacterium atrosepticum SCRI1043
Replicon chromosome
Sequence Protein sequence (144 a.a.); Nucleotide sequence (432 bp)
Reference
[1] Mattinen L, Somervuo P, Nykyri J, et al. Microarray profiling of host-extract-induced genes and characterization of the type VI secretion cluster in the potato pathogen Pectobacterium atrosepticum. Microbiology (Reading). 2008 Aug;154(Pt 8):2387-2396. doi: 10.1099/mic.0.2008/017582-0. PMID: 18667571
[2] Mattinen L, Nissinen R, Riipi T, et al. Host-extract induced changes in the secretome of the plant pathogenic bacterium Pectobacterium atrosepticum. Proteomics. 2007 Oct;7(19):3527-37. PMID: 17726675
[3] Liu H, Coulthurst SJ, Pritchard L, et al. Quorum sensing coordinates brute force and stealth modes of infection in the plant pathogen Pectobacterium atrosepticum. PLoS Pathog. 2008 Jun 20;4(6):e1000093. doi: 10.1371/journal.ppat.1000093. PMID: 18566662
[4] Boyer F, Fichant G, Berthod J, et al. Dissecting the bacterial type VI secretion system by a genome wide in silico analysis: what can be learned from available microbial genomic resources? BMC Genomics. 2009 Mar 12;10:104. doi: 10.1186/1471-2164-10-104. PMID: 19284603
[5] Bernard CS, Brunet YR, Gavioli M, et al. Regulation of type VI secretion gene clusters by sigma54 and cognate enhancer binding proteins. J Bacteriol. 2011 May;193(9):2158-67. doi: 10.1128/JB.00029-11. Epub 2011 Mar 4. PMID: 21378190
experimental Experimental investigation has been performed on this T6SS
External database links

Locus tag (Gene) ECA_RS16980
Coordinate (Strand) 3861519..3861950 (-)
NCBI ID WP_011094951.1
RefSeq NC_004547
Uniprot ID A0A1V2R081_9GAMM, Q6D1K3_PECAS, A0A518VI10_PECCC
KEGG ID eca:ECA3443
PDB ID -
Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
GPW_gp25 PF04965.16 2.6e-17 34..122
Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-143 MPSLSAWERGSAASLFDRIRGEERRSSPETEVEALIESVKRQLDNVLNTRPGNCRSAPELGVIDFNDATQGGADIRGKIREAIRQCICRFEPRIVHVDVNTSDYLSNPMEMSFQVTARVRLEDLEQVASFNIHMDSHRHYRMI


Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9733 - -


  Protein sequence: 144 a.a.    

>T6CP008458 NC_004547:c3861950-3861519 [Pectobacterium atrosepticum SCRI1043] [TssE]
MPSLSAWERGSAASLFDRIRGEERRSSPETEVEALIESVKRQLDNVLNTRPGNCRSAPELGVIDFNDATQGGADIRGKIR
EAIRQCICRFEPRIVHVDVNTSDYLSNPMEMSFQVTARVRLEDLEQVASFNIHMDSHRHYRMI*

  Nucleotide sequence: 432 bp    

>T6CP008458 NC_004547:c3861950-3861519 [Pectobacterium atrosepticum SCRI1043] [TssE]
ATGCCGTCTCTTTCTGCCTGGGAAAGGGGAAGCGCGGCAAGTCTGTTTGATCGTATCCGTGGGGAGGAACGTCGTTCCTC
CCCTGAAACGGAAGTTGAAGCACTGATCGAGTCCGTTAAGCGTCAACTGGACAACGTGCTCAACACCCGGCCCGGAAATT
GCCGCAGCGCACCTGAGCTTGGCGTGATTGATTTTAATGACGCGACGCAGGGTGGTGCGGATATTCGGGGGAAAATCCGG
GAGGCGATCCGACAGTGTATCTGTCGCTTTGAACCTCGAATTGTTCATGTAGATGTCAACACGTCGGACTATTTATCGAA
TCCGATGGAGATGTCGTTTCAGGTTACCGCCCGGGTCAGATTGGAAGATCTGGAGCAGGTCGCCTCTTTCAATATCCACA
TGGATAGCCACCGTCATTACAGAATGATCTGA