Detailed information of component protein


Summary

Component ID T6CP005729
Component protein type TssK
T6SS ID (Type) T6SS00540 experimental (Type i3)
Strain Pseudomonas fluorescens F113
Replicon chromosome
Sequence Protein sequence (445 a.a.); Nucleotide sequence (1335 bp)
Reference
[1] Barret M, Egan F, Fargier E, et al. Genomic analysis of the type VI secretion systems in Pseudomonas spp.: novel clusters and putative effectors uncovered. Microbiology (Reading). 2011 Jun;157(Pt 6):1726-1739. doi: 10.1099/mic.0.048645-0. Epub 2011 Apr 7. PMID: 21474537
[2] Redondo-Nieto M, Barret M, Morrissey J, et al. Genome sequence reveals that Pseudomonas fluorescens F113 possesses a large and diverse array of systems for rhizosphere function and host interaction. BMC Genomics. 2013 Jan 25;14:54. doi: 10.1186/1471-2164-14-54. PMID: 23350846
[3] Durán D, Bernal P, Vazquez-Arias D, et al. Pseudomonas fluorescens F113 type VI secretion systems mediate bacterial killing and adaption to the rhizosphere microbiome. Sci Rep. 2021 Mar 11;11(1):5772. doi: 10.1038/s41598-021-85218-1. PMID: 33707614
experimental Experimental investigation has been performed on this T6SS
External database links

Locus tag (Gene)
Coordinate (Strand) 6677200..6678534 (-)
NCBI ID WP_014340882.1
RefSeq NC_016830
Uniprot ID G8Q712_PSEF3, A0A1V3S308_9PSED
KEGG ID pfe:PSF113_5794
PDB ID -
Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-444 MSWNNRVVWSEGMFIGTQHFQQHDRYLENLIDARSRPLSAGAWGFSELLIDQGLLAQGKLAIISARGLLPDGTPFNIPQDDLAPIPLNVDDNLRDGLVYLALPLKRAGARDTVDAGEDLGAARYVSQVCEVRDDNAPFENRAPVALGSRALRLLTEQDGIGDYAAIGVVRIKEKRADRALVLDDAYIPPLLDVIASKPLAAFRSELLGLLHQRGEALAGRVVASGAGGASEIADFMLLQLVNRAQPLIQHLSQLSPLHPERFYSELVSLAGEFSTFTASGRRPQQYPPYQHDDLALSYAPVMQALREALSMLIDSKATPIPIVEKAYGIHVAMLADKTLLDSASFILVVRADVPAETLRGRFGQQSKVGSVEHIRDLVNLQLPGIGLLPLPVAPRQLPYHAGSTYYELDRGSDHWQQLSNSGGFAFHIAGQFPGLNLAFWAIRG


Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9949 - -


  Protein sequence: 445 a.a.    


  Nucleotide sequence: 1335 bp