Detailed information of component protein


Summary

Component ID T6CP005719
Component protein type TssG
T6SS ID (Type) T6SS00539 experimental (Type i4a)
Strain Pseudomonas fluorescens F113
Replicon chromosome
Sequence Protein sequence (342 a.a.); Nucleotide sequence (1026 bp)
Reference
[1] Barret M, Egan F, Fargier E, et al. Genomic analysis of the type VI secretion systems in Pseudomonas spp.: novel clusters and putative effectors uncovered. Microbiology (Reading). 2011 Jun;157(Pt 6):1726-1739. doi: 10.1099/mic.0.048645-0. Epub 2011 Apr 7. PMID: 21474537
[2] Redondo-Nieto M, Barret M, Morrissey J, et al. Genome sequence reveals that Pseudomonas fluorescens F113 possesses a large and diverse array of systems for rhizosphere function and host interaction. BMC Genomics. 2013 Jan 25;14:54. doi: 10.1186/1471-2164-14-54. PMID: 23350846
[3] DurĂ¡n D, Bernal P, Vazquez-Arias D, et al. Pseudomonas fluorescens F113 type VI secretion systems mediate bacterial killing and adaption to the rhizosphere microbiome. Sci Rep. 2021 Mar 11;11(1):5772. doi: 10.1038/s41598-021-85218-1. PMID: 33707614
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) PSF113_RS42595
Coordinate (Strand) 2812931..2813956 (-)
NCBI ID WP_014337902.1
RefSeq NC_016830
Uniprot ID G8QBH4_PSEO1
KEGG ID pfe:PSF113_2412
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_TssG PF06996.13 1.9e-77 22..320

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-341 MATPSRQTPGALNLSERLRRDPQRFEWLQALLLLEREHPQAEPLGSGTAPHAEALRLRGPLTPLFAASEVESLRQEPGLPPTLTTPIFGLGGPDGPLPYAYQEWLQQRARAKDYAPAEFLDLFQHRLLSLLYKVMRKHRIALGFTAPGSSAVHAQLRALTGLLPKALQERQAVPDSAVLACTALYADGRRSLDGFAAIVREQFGLPVELNAYEGGWREIPPASRSRLQPGGRNLRLGRNAVAGTHVWDEHAGVRLTLGPLTTGQASELLPNGETHPLLASLYALYFGPDLDCTLVLLIRGAGPLQLDRQAAPRLNWNGGLQRQPTLAVQRIETRLRQPEIA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9599 - -



  Protein sequence: 342 a.a.    

>T6CP005719 NC_016830:c2813956-2812931 [Pseudomonas fluorescens F113] [TssG]
MATPSRQTPGALNLSERLRRDPQRFEWLQALLLLEREHPQAEPLGSGTAPHAEALRLRGPLTPLFAASEVESLRQEPGLP
PTLTTPIFGLGGPDGPLPYAYQEWLQQRARAKDYAPAEFLDLFQHRLLSLLYKVMRKHRIALGFTAPGSSAVHAQLRALT
GLLPKALQERQAVPDSAVLACTALYADGRRSLDGFAAIVREQFGLPVELNAYEGGWREIPPASRSRLQPGGRNLRLGRNA
VAGTHVWDEHAGVRLTLGPLTTGQASELLPNGETHPLLASLYALYFGPDLDCTLVLLIRGAGPLQLDRQAAPRLNWNGGL
QRQPTLAVQRIETRLRQPEIA*

  Nucleotide sequence: 1026 bp    

>T6CP005719 NC_016830:c2813956-2812931 [Pseudomonas fluorescens F113] [TssG]
ATGGCAACCCCAAGCCGGCAAACCCCTGGTGCTCTGAACCTGAGCGAGCGACTGCGGCGCGACCCGCAACGCTTCGAATG
GCTCCAGGCCCTGCTGTTGCTCGAACGTGAACACCCCCAGGCCGAGCCCCTGGGCAGCGGCACCGCGCCGCACGCCGAAG
CCTTGCGTCTGCGCGGGCCCTTGACGCCGCTGTTCGCCGCCAGCGAAGTGGAAAGCCTGCGCCAGGAACCCGGCCTGCCG
CCAACCCTGACTACGCCGATCTTCGGCCTTGGCGGCCCCGACGGCCCGTTGCCCTACGCCTATCAGGAATGGCTGCAACA
ACGGGCAAGGGCGAAGGACTATGCCCCGGCGGAATTCCTCGACCTGTTCCAGCATCGCCTGCTCAGCCTGCTTTACAAGG
TGATGCGCAAACATCGCATCGCCTTGGGTTTCACTGCCCCGGGATCGTCCGCCGTACACGCGCAACTGCGGGCGTTGACC
GGCCTGCTGCCCAAAGCCTTGCAGGAGCGCCAGGCCGTCCCCGACTCGGCGGTACTGGCCTGCACCGCACTGTACGCCGA
TGGCCGGCGCTCCCTGGACGGGTTCGCGGCGATTGTCCGGGAACAGTTCGGGCTGCCCGTGGAGCTGAACGCCTACGAAG
GTGGCTGGCGTGAAATCCCGCCGGCCAGCCGCAGCCGCTTGCAACCGGGCGGGCGCAACCTGCGCCTGGGCCGCAACGCG
GTGGCCGGTACACACGTCTGGGACGAACATGCTGGCGTGCGCCTGACCCTCGGGCCGCTGACCACGGGCCAGGCCAGCGA
ACTGCTGCCCAACGGCGAAACCCATCCGCTGCTCGCCAGTCTCTACGCCCTGTACTTCGGCCCCGATCTGGATTGCACCC
TGGTACTGCTGATCCGTGGTGCCGGCCCACTGCAACTGGACCGCCAGGCAGCGCCACGGCTGAACTGGAACGGTGGCCTG
CAACGCCAGCCAACCCTCGCCGTGCAACGGATCGAAACCCGTCTTCGCCAGCCGGAGATTGCCTGA