Detailed information of component protein


Summary

Component ID T6CP000352
Component protein type TssE
T6SS ID (Type) T6SS00042 experimental (Type i1)
Strain Pseudomonas syringae pv. tomato str. DC3000
Replicon chromosome
Sequence Protein sequence (136 a.a.); Nucleotide sequence (408 bp)
Reference
[1] Haapalainen M, Mosorin H, Dorati F, et al. Hcp2, a secreted protein of the phytopathogen Pseudomonas syringae pv. tomato DC3000, is required for fitness for competition against bacteria and yeasts. J Bacteriol. 2012 Sep;194(18):4810-22. doi: 10.1128/JB.00611-12. Epub 2012 Jun 29. PMID: 22753062
[2] Sarris PF, Skandalis N, Kokkinidis M, et al. In silico analysis reveals multiple putative type VI secretion systems and effector proteins in Pseudomonas syringae pathovars. Mol Plant Pathol. 2010 Nov;11(6):795-804. doi: 10.1111/j.1364-3703.2010.00644.x. PMID: 21091602
[3] Boyer F, Fichant G, Berthod J, et al. Dissecting the bacterial type VI secretion system by a genome wide in silico analysis: what can be learned from available microbial genomic resources? BMC Genomics. 2009 Mar 12;10:104. doi: 10.1186/1471-2164-10-104. PMID: 19284603
[4] Barret M, Egan F, Fargier E, et al. Genomic analysis of the type VI secretion systems in Pseudomonas spp.: novel clusters and putative effectors uncovered. Microbiology (Reading). 2011 Jun;157(Pt 6):1726-1739. doi: 10.1099/mic.0.048645-0. Epub 2011 Apr 7. PMID: 21474537
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) PSPTO_RS28110
Coordinate (Strand) 6176297..6176704 (-)
NCBI ID WP_011105491.1
RefSeq NC_004578
Uniprot ID A0A3M4KLD1_PSESF, A0A0N8RCT1_9PSED, Q87U77_PSESM, A0A0Q0B5V2_PSEUB, A0A3M2UXI1_PSEYM
KEGG ID pst:PSPTO_5431
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
GPW_gp25 PF04965.16 8.7e-17 26..113

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-135 MTGYGSLFERLNGDAEKRVSWSREVSATASVAAHLAKMLSTRAGSVQTLSDYGLPDLNDMRLSLHDSLTQARLAIESFIEAYEPRLSNVRVISLPRDHDQLRLSFSIEGLLEVEGFKRQVSFAARLDGSGQVKVN



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.7666 - -



  Protein sequence: 136 a.a.    

>T6CP000352 NC_004578:c6176704-6176297 [Pseudomonas syringae pv. tomato str. DC3000] [TssE]
MTGYGSLFERLNGDAEKRVSWSREVSATASVAAHLAKMLSTRAGSVQTLSDYGLPDLNDMRLSLHDSLTQARLAIESFIE
AYEPRLSNVRVISLPRDHDQLRLSFSIEGLLEVEGFKRQVSFAARLDGSGQVKVN*

  Nucleotide sequence: 408 bp    

>T6CP000352 NC_004578:c6176704-6176297 [Pseudomonas syringae pv. tomato str. DC3000] [TssE]
ATGACTGGATACGGCAGCCTTTTCGAACGCCTCAATGGCGATGCGGAAAAACGCGTCAGCTGGAGCCGCGAGGTTTCAGC
CACGGCCTCCGTGGCTGCCCATCTGGCCAAGATGCTCAGCACCCGTGCGGGCAGCGTGCAAACGCTGTCCGACTACGGGC
TACCCGATCTCAATGACATGCGCCTGAGCCTGCACGACTCGCTGACTCAGGCCCGTTTGGCCATCGAAAGCTTCATCGAA
GCCTACGAGCCGCGCTTGAGCAATGTGCGTGTCATTTCCCTGCCGCGTGATCACGATCAGCTTCGCCTGTCCTTCAGCAT
TGAAGGCCTGCTGGAAGTCGAGGGTTTCAAGCGTCAGGTCAGTTTCGCCGCTCGCCTGGATGGTAGCGGTCAAGTGAAGG
TTAATTAA