Detailed information of component protein


Summary

Component ID T6CP000104
Component protein type TssC
T6SS ID (Type) T6SS00014 experimental (Type i4b)
Strain Pseudomonas putida KT2440
Replicon chromosome
Sequence Protein sequence (501 a.a.); Nucleotide sequence (1503 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) PP_RS16050
Coordinate (Strand) 3494711..3496213 (-)
NCBI ID WP_003248356.1
RefSeq NC_002947
Uniprot ID I7AZX8_PSEPT, A0A2I0CH73_9PSED, A0A173HEZ5_9PSED, Q88IA0_PSEPK, A0A2L0SYZ6_9PSED, A0A2K4LNU4_9PSED, I3V3X5_PSEPU, A0A1X1AEN5_PSEPU, A5W3P7_PSEP1, A0A2V4FUV1_9PSED, A0A7L9GCV7_9PSED, A0A2N1IWE2_9PSED
KEGG ID ppx:T1E_2458, ppu:PP_3099, ppf:Pput_2623, ppi:YSA_10469
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
VipB PF05943.14 1.9e-143 73..374
VipB_2 PF18945.2 1.8e-44 384..494

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-500 MTDKQTAPQQAGDLVEVENFAPQPSLLDSIISQSRVARSDTERNRTRDLIGELVNQVLEGEMTPSKDLIAVLDSRIAEIDAMLSEQMNEIMHAREFQQLEASWRGLKYQVDQTETSTTLKIHLLNASKKDLVRDLKAASEFDQSALFKKVYEEEYGTFGGAPFGMLIGDYEFNRNPEDMYLLEEISHVAAAAHAPFISAASSELFGWDSFTEMSGPRDLAKIFDTVEYAKWKSFRASEDSRYVGLTLPHVLGRLPYGPDTTPVEEFNFVESVDGRDHNKYLWMNAAYALGTRVTDAFARYGWCVAIRGVEGGGLVEGLPTHTFKTDDGEIALKCPTEIAITDRREKELSDLGFIPLVHCKGTDYAAFFGTQSAQKQKQYNTDIANANARLSAQLQYIFATSRIAHYMKAIMRDKIGSFASRMDVERFLNQWLASYVLLDDTASQEAKAKFPLREARAEVFEVPGKPGVYKAVTYLRPHYQLDELTASLRLVAELPQGARG



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9899 - -



  Protein sequence: 501 a.a.    

>T6CP000104 NC_002947:c3496213-3494711 [Pseudomonas putida KT2440] [TssC]
MTDKQTAPQQAGDLVEVENFAPQPSLLDSIISQSRVARSDTERNRTRDLIGELVNQVLEGEMTPSKDLIAVLDSRIAEID
AMLSEQMNEIMHAREFQQLEASWRGLKYQVDQTETSTTLKIHLLNASKKDLVRDLKAASEFDQSALFKKVYEEEYGTFGG
APFGMLIGDYEFNRNPEDMYLLEEISHVAAAAHAPFISAASSELFGWDSFTEMSGPRDLAKIFDTVEYAKWKSFRASEDS
RYVGLTLPHVLGRLPYGPDTTPVEEFNFVESVDGRDHNKYLWMNAAYALGTRVTDAFARYGWCVAIRGVEGGGLVEGLPT
HTFKTDDGEIALKCPTEIAITDRREKELSDLGFIPLVHCKGTDYAAFFGTQSAQKQKQYNTDIANANARLSAQLQYIFAT
SRIAHYMKAIMRDKIGSFASRMDVERFLNQWLASYVLLDDTASQEAKAKFPLREARAEVFEVPGKPGVYKAVTYLRPHYQ
LDELTASLRLVAELPQGARG*

  Nucleotide sequence: 1503 bp    

>T6CP000104 NC_002947:c3496213-3494711 [Pseudomonas putida KT2440] [TssC]
ATGACCGACAAGCAAACCGCACCGCAACAGGCCGGCGACCTGGTCGAAGTGGAAAACTTCGCACCACAGCCCTCGCTGCT
CGACAGCATCATTTCGCAAAGCCGCGTGGCCCGCTCCGACACCGAGCGCAACCGCACCCGCGACCTGATTGGCGAACTGG
TGAACCAGGTGCTCGAGGGTGAGATGACCCCGAGCAAGGACCTGATCGCCGTGCTCGATTCGCGCATCGCCGAGATCGAC
GCGATGCTCTCCGAGCAGATGAACGAGATCATGCACGCCCGCGAGTTTCAGCAGTTGGAAGCCTCCTGGCGCGGCCTGAA
ATACCAGGTAGACCAGACCGAGACCAGCACCACGCTGAAGATCCACCTGCTCAATGCCTCGAAGAAAGACCTGGTACGCG
ACCTGAAGGCCGCCAGCGAATTTGACCAGAGCGCACTGTTCAAGAAGGTCTACGAAGAAGAGTACGGCACCTTCGGTGGC
GCGCCTTTCGGCATGTTGATCGGTGACTACGAGTTCAACCGCAACCCTGAAGACATGTACCTGCTCGAAGAGATCTCGCA
CGTCGCGGCGGCGGCGCACGCGCCGTTCATCTCGGCCGCTTCGTCCGAGCTGTTCGGCTGGGACTCGTTCACCGAGATGT
CCGGCCCGCGTGACCTGGCGAAGATCTTCGACACCGTGGAATACGCCAAGTGGAAGTCGTTCCGCGCCTCGGAAGACTCG
CGTTACGTCGGCCTCACCCTGCCCCACGTGCTCGGTCGCCTGCCGTATGGACCGGATACCACCCCGGTGGAAGAATTCAA
CTTCGTCGAAAGCGTCGATGGCCGCGACCACAACAAGTACCTGTGGATGAACGCCGCCTACGCCCTCGGCACCCGGGTCA
CCGATGCCTTCGCCCGCTACGGCTGGTGCGTGGCCATCCGCGGCGTGGAAGGTGGCGGCCTGGTCGAAGGCCTGCCGACC
CATACCTTCAAGACCGACGACGGCGAAATCGCCCTCAAGTGCCCGACCGAAATCGCCATCACCGATCGCCGCGAAAAAGA
GCTGTCGGACCTGGGCTTCATCCCCCTGGTGCACTGCAAGGGCACCGACTATGCCGCGTTCTTCGGCACCCAGTCGGCGC
AGAAACAGAAGCAGTACAACACCGACATCGCCAACGCCAACGCACGCCTGTCGGCCCAGCTGCAATACATCTTCGCCACT
TCGCGCATCGCCCACTACATGAAGGCGATCATGCGCGACAAGATCGGCAGCTTCGCCTCGCGCATGGATGTCGAGCGCTT
CCTCAACCAGTGGCTGGCCAGCTACGTGCTGCTCGACGATACCGCCAGCCAGGAGGCCAAGGCCAAGTTCCCGCTGCGCG
AAGCCCGCGCCGAGGTGTTCGAAGTGCCCGGCAAGCCAGGCGTGTACAAGGCCGTGACCTACTTGCGCCCGCACTACCAG
CTGGATGAGCTGACCGCCTCGCTGCGGCTGGTTGCCGAGCTGCCACAGGGCGCGCGCGGCTGA