Detailed information of component protein


Summary

Component ID T6CP000101
Component protein type TssG
T6SS ID (Type) T6SS00014 experimental (Type i4b)
Strain Pseudomonas putida KT2440
Replicon chromosome
Sequence Protein sequence (357 a.a.); Nucleotide sequence (1071 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) PP_RS16035
Coordinate (Strand) 3491348..3492418 (-)
NCBI ID WP_003248350.1
RefSeq NC_002947
Uniprot ID A0A173HFK0_9PSED, A0A1Y5KXG0_PSEPU, A0A2I0CH70_9PSED, A0A2V4FJR9_9PSED, Q88IA3_PSEPK
KEGG ID ppu:PP_3096
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_TssG PF06996.13 6.2e-104 19..333

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-356 MASTHRRSAPGLIDQARAEPHRFEFFQLVRLLRLHYSRTGRMDLATRPHEDPLRFRTQLSLAFPASEVSDLHFEREGKVSPAGLPLSEVQVTFMGLVGPSGVLPRPYTELLLERHVQYRDDAAHAFLDIFSHRMTTLFYEAWQKYKFHIEHERNGTSGFDGYLLNLVGLGPRAQKLKFEEQPSALRRELFSYFAGLLSQKPRNALNLERMLGFYFSLPIKVQPFAGRWLHLQPEQCTQLGRRNAQLGHSAVAGNRVWDYQSCIRIELGPLSLADYQRFQPGTACYRKLVELVRFYIGAELDFEIAPRLKREAVPRAQLGRSGNVALGWLGWLKRPGRDAEPSRCAVFHIPYDGVAL



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9820 - -



  Protein sequence: 357 a.a.    

>T6CP000101 NC_002947:c3492418-3491348 [Pseudomonas putida KT2440] [TssG]
MASTHRRSAPGLIDQARAEPHRFEFFQLVRLLRLHYSRTGRMDLATRPHEDPLRFRTQLSLAFPASEVSDLHFEREGKVS
PAGLPLSEVQVTFMGLVGPSGVLPRPYTELLLERHVQYRDDAAHAFLDIFSHRMTTLFYEAWQKYKFHIEHERNGTSGFD
GYLLNLVGLGPRAQKLKFEEQPSALRRELFSYFAGLLSQKPRNALNLERMLGFYFSLPIKVQPFAGRWLHLQPEQCTQLG
RRNAQLGHSAVAGNRVWDYQSCIRIELGPLSLADYQRFQPGTACYRKLVELVRFYIGAELDFEIAPRLKREAVPRAQLGR
SGNVALGWLGWLKRPGRDAEPSRCAVFHIPYDGVAL*

  Nucleotide sequence: 1071 bp    

>T6CP000101 NC_002947:c3492418-3491348 [Pseudomonas putida KT2440] [TssG]
ATGGCCAGCACGCACCGGCGATCAGCCCCTGGTCTGATCGATCAGGCCCGAGCCGAGCCGCACCGATTCGAATTCTTTCA
ATTGGTGCGCCTGCTCCGCCTGCACTACAGCCGCACCGGGCGCATGGACCTGGCAACCCGGCCGCACGAAGACCCGCTGC
GTTTTCGTACCCAGCTGTCGCTGGCGTTCCCGGCCAGCGAGGTCAGCGACCTGCACTTCGAGCGCGAAGGCAAGGTGTCG
CCGGCCGGCTTGCCGCTGTCGGAAGTGCAGGTCACCTTCATGGGCCTGGTCGGGCCGTCGGGCGTGCTGCCACGCCCGTA
CACCGAGCTGCTGCTCGAGCGCCACGTGCAGTATCGCGACGATGCCGCCCATGCGTTTCTCGACATCTTCTCGCACCGCA
TGACCACGTTGTTCTACGAGGCCTGGCAAAAATACAAATTCCACATCGAGCACGAGCGCAATGGCACCTCGGGCTTCGAT
GGCTACCTGCTCAACCTGGTTGGCCTCGGGCCGCGCGCCCAGAAGCTGAAGTTCGAAGAGCAACCGTCAGCATTGCGTCG
TGAGCTGTTCAGCTATTTTGCCGGCCTGCTCAGCCAGAAGCCGCGCAATGCGCTGAACCTTGAACGCATGCTCGGCTTCT
ACTTCTCGCTGCCGATCAAGGTACAGCCGTTCGCCGGGCGCTGGCTGCACCTGCAGCCCGAACAATGCACCCAGCTCGGC
CGCCGCAATGCCCAGCTCGGCCACAGCGCCGTCGCCGGCAACCGGGTCTGGGACTACCAGTCGTGCATCCGCATCGAGCT
GGGCCCGCTCAGCCTGGCCGACTACCAGCGCTTCCAGCCGGGCACCGCCTGCTACCGCAAGCTGGTCGAGTTGGTGCGCT
TCTATATAGGTGCCGAACTGGATTTCGAAATTGCCCCGCGCCTCAAGCGCGAGGCGGTACCACGCGCCCAACTGGGCCGC
AGCGGCAATGTCGCCCTGGGCTGGCTGGGTTGGCTCAAACGCCCTGGTCGTGACGCGGAGCCTTCGCGTTGCGCCGTCTT
CCACATTCCTTACGATGGGGTCGCCTTGTGA