Detailed information of component protein


Summary

Component ID T6CP000099
Component protein type TssJ
T6SS ID (Type) T6SS00014 experimental (Type i4b)
Strain Pseudomonas putida KT2440
Replicon chromosome
Sequence Protein sequence (241 a.a.); Nucleotide sequence (723 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) PP_RS16025
Coordinate (Strand) 3488007..3488729 (-)
NCBI ID WP_004576638.1
RefSeq NC_002947
Uniprot ID A0A2I0CH72_9PSED, A0A2K4LQ44_9PSED, A0A2V4FBR6_9PSED, A0A4U9M678_PSEPU, A5W3Q2_PSEP1, I3V3X0_PSEPU, Q88IA5_PSEPK
KEGG ID ppf:Pput_2628, ppi:YSA_10461, ppu:PP_3094
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS-SciN PF12790.9 4.2e-30 47..161

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-240 MQHKHIVLKRLTAAALLVALAGCGVTDRIGKRMEDSWAADMLADSEKVILTSDGGNQLNPDAEGKPLSVVMRVYQLTDLERFAATDAETLWDAPQKALGNTLVETREITLLPGIGQIDQWPLAKNARYVGVAAFFRDEQDARWKVAFDANSLRKDGIWFSSDGLRVLVDNTEISAMRGVDVLNKPPTADQLAAAQKAKDADATLTDKVQDAAIDKATDAASQSASNAMDSTFNSLVDSVK



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
LIPO(Sec/SPII) 0.9986 pos: 22-23. LAG-CG. MQHKHIVLKRLTAAALLVALAG



  Protein sequence: 241 a.a.    

>T6CP000099 NC_002947:c3488729-3488007 [Pseudomonas putida KT2440] [TssJ]
MQHKHIVLKRLTAAALLVALAGCGVTDRIGKRMEDSWAADMLADSEKVILTSDGGNQLNPDAEGKPLSVVMRVYQLTDLE
RFAATDAETLWDAPQKALGNTLVETREITLLPGIGQIDQWPLAKNARYVGVAAFFRDEQDARWKVAFDANSLRKDGIWFS
SDGLRVLVDNTEISAMRGVDVLNKPPTADQLAAAQKAKDADATLTDKVQDAAIDKATDAASQSASNAMDSTFNSLVDSVK
*

  Nucleotide sequence: 723 bp    

>T6CP000099 NC_002947:c3488729-3488007 [Pseudomonas putida KT2440] [TssJ]
ATGCAACACAAGCACATCGTCCTCAAACGCCTGACCGCAGCCGCCTTGCTGGTAGCGCTGGCCGGCTGCGGGGTCACCGA
CCGTATCGGCAAGCGCATGGAAGACAGCTGGGCGGCCGACATGCTGGCCGACAGCGAAAAGGTCATCCTGACCTCCGACG
GCGGCAACCAGCTCAACCCCGACGCCGAGGGCAAGCCGCTGTCGGTGGTGATGCGCGTGTATCAGCTGACCGACCTCGAG
CGCTTCGCGGCTACCGATGCCGAGACCCTGTGGGACGCCCCGCAAAAAGCCTTGGGCAACACCCTGGTGGAAACCCGCGA
GATCACCCTGCTGCCCGGCATTGGCCAGATCGACCAGTGGCCGCTGGCCAAGAACGCGCGCTACGTCGGCGTGGCGGCGT
TCTTCCGCGATGAGCAGGACGCGCGCTGGAAAGTCGCCTTCGACGCCAACTCGCTGCGCAAGGACGGTATCTGGTTCTCC
TCCGACGGCCTGCGGGTACTGGTGGACAACACCGAAATCAGCGCCATGCGGGGCGTGGACGTACTGAACAAACCGCCGAC
CGCCGACCAGCTTGCCGCTGCGCAGAAGGCCAAGGATGCCGACGCGACCCTCACCGACAAGGTGCAGGACGCGGCCATCG
ACAAAGCCACCGACGCCGCCAGCCAGTCGGCCAGCAACGCCATGGATTCAACCTTCAACTCTTTAGTGGATAGCGTCAAA
TGA