Detailed information of component protein


Summary

Component ID T6CP000097
Component protein type TssM
T6SS ID (Type) T6SS00014 experimental (Type i4b)
Strain Pseudomonas putida KT2440
Replicon chromosome
Sequence Protein sequence (1268 a.a.); Nucleotide sequence (3804 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) PP_RS16010
Coordinate (Strand) 3482120..3485923 (-)
NCBI ID WP_010953989.1
RefSeq NC_002947
Uniprot ID A0A2V4FES1_9PSED, Q88IA8_PSEPK
KEGG ID ppu:PP_3091
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
IcmF-related_N PF14331.8 5.7e-56 181..432
IcmF-related PF06761.14 2.4e-50 491..878
IcmF_C PF06744.14 7e-20 1142..1241

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Inside 1-12 MKTLLRLLKSFW
Transmembrane helix 13-35 LLLPLLWLASLLICWLAAPLVPW
Outside 36-39 LRHH
Transmembrane helix 40-57 VPEALAIISACFLLVIVL
Inside 58-433 RQYQRIRAEHNLENLLQIEVDRSWNATGEFRDQQVLRERLKHAITMLRTDRSAGGGGKAALSDLPWYLVVGMSAAGKTSLLTHSGLSASIATANDSESGTQHCDWYFSPDAVMIDTAGRYLRDDQSASEFSAFLRMLRKQRGKAAINGLVLVVSLPELLAANSDERNALAAQLVARVEEYAECLDANPPVYLMLSKTDQLPGFSQAFDGLDLHERQQPLGMTFGLSEIRTNGLHAVLQTRLKKLQAHIRQHVDAQMIALGAEADSTLLNFPQYFAALSGVLEQFLEHFTRGHRGGAPLLLRGLYFTSALQNGQQLGQVYEDVIADEFALQAAYDEQAGHVGKALGNRSYFITDTFRQVIFPDRDLILYQSRLGRQA
Transmembrane helix 434-456 AFSPLLLGLAAATGLLFIGWQAL
Outside 457-1267 SFANNRQWLDSLRGQLAHIEQAADREQQLAAGKGLEVLREQMANVKAHRLQGVPLQLGGGLYQGEAIHQVTRSAYLAQLRSQALEPIARSLQVQMRAFNTFANGINQELEFTPAPQPKKRNGKPLAPAIAARAKAALGNTRAGAYAAKVNLATASDGAELSAATGGLSLSEEMLGRLDEQQVASIIEAYNTLKLYLLLTEPQAHPDPAFVAASLPQAWASAAGEGTPADAGVIAENAPLYVQLLEQGQAPSLPRNEQLINETRQNLKSFMISSSLVDREYLRLQLESSRQFPALSLNDLVPQPGRALLYGTAGVPAIYTRQGWDTFVKPELIKLVSGNLRNESDWVLDGEGGDALVQKANFVREFMTRYKRDYTQAWYKMVSSVGVRHFADLASATRELGLLSDVQNSPVKNLLQAVNDNTQWDLPVKQAIPAPGTSRDDGFWSKVTGLFDANDTLPANVAPALPAVDDGSLAKRFEPVARVFAENNAEGADSTIMDRYLAALRKLKVRMNNIQRSQDVGKSSKQLISETLEGQPSEITTVRNYVESSVDTSQDGLSRSLQGLFSLPIQYAWATLRDPAGEQIAKAWAQQIAKPWEQVMAHRYPIAGSSRNEASVKDLQRFVDPDSGLLPAFKRNEIGNLAGGEGLGVGDGKGPALVNPGMLNSIDKASSVGQVIASLSDRDNGFEIMLEPSANFTDIVFTLDGQEQHYRNGRSSWNRFAWPGTSTAPGARLDVVTLSGTRVTVFDFPGRWGLLRMNESARVDDLDGIQQRFSWNTASGRVSLVVRNFGGVKLTDLGDVKALSALNSRGAQ



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9635 - -



  Protein sequence: 1268 a.a.    

>T6CP000097 NC_002947:c3485923-3482120 [Pseudomonas putida KT2440] [TssM]
MKTLLRLLKSFWLLLPLLWLASLLICWLAAPLVPWLRHHVPEALAIISACFLLVIVLRQYQRIRAEHNLENLLQIEVDRS
WNATGEFRDQQVLRERLKHAITMLRTDRSAGGGGKAALSDLPWYLVVGMSAAGKTSLLTHSGLSASIATANDSESGTQHC
DWYFSPDAVMIDTAGRYLRDDQSASEFSAFLRMLRKQRGKAAINGLVLVVSLPELLAANSDERNALAAQLVARVEEYAEC
LDANPPVYLMLSKTDQLPGFSQAFDGLDLHERQQPLGMTFGLSEIRTNGLHAVLQTRLKKLQAHIRQHVDAQMIALGAEA
DSTLLNFPQYFAALSGVLEQFLEHFTRGHRGGAPLLLRGLYFTSALQNGQQLGQVYEDVIADEFALQAAYDEQAGHVGKA
LGNRSYFITDTFRQVIFPDRDLILYQSRLGRQAAFSPLLLGLAAATGLLFIGWQALSFANNRQWLDSLRGQLAHIEQAAD
REQQLAAGKGLEVLREQMANVKAHRLQGVPLQLGGGLYQGEAIHQVTRSAYLAQLRSQALEPIARSLQVQMRAFNTFANG
INQELEFTPAPQPKKRNGKPLAPAIAARAKAALGNTRAGAYAAKVNLATASDGAELSAATGGLSLSEEMLGRLDEQQVAS
IIEAYNTLKLYLLLTEPQAHPDPAFVAASLPQAWASAAGEGTPADAGVIAENAPLYVQLLEQGQAPSLPRNEQLINETRQ
NLKSFMISSSLVDREYLRLQLESSRQFPALSLNDLVPQPGRALLYGTAGVPAIYTRQGWDTFVKPELIKLVSGNLRNESD
WVLDGEGGDALVQKANFVREFMTRYKRDYTQAWYKMVSSVGVRHFADLASATRELGLLSDVQNSPVKNLLQAVNDNTQWD
LPVKQAIPAPGTSRDDGFWSKVTGLFDANDTLPANVAPALPAVDDGSLAKRFEPVARVFAENNAEGADSTIMDRYLAALR
KLKVRMNNIQRSQDVGKSSKQLISETLEGQPSEITTVRNYVESSVDTSQDGLSRSLQGLFSLPIQYAWATLRDPAGEQIA
KAWAQQIAKPWEQVMAHRYPIAGSSRNEASVKDLQRFVDPDSGLLPAFKRNEIGNLAGGEGLGVGDGKGPALVNPGMLNS
IDKASSVGQVIASLSDRDNGFEIMLEPSANFTDIVFTLDGQEQHYRNGRSSWNRFAWPGTSTAPGARLDVVTLSGTRVTV
FDFPGRWGLLRMNESARVDDLDGIQQRFSWNTASGRVSLVVRNFGGVKLTDLGDVKALSALNSRGAQ*

  Nucleotide sequence: 3804 bp    

>T6CP000097 NC_002947:c3485923-3482120 [Pseudomonas putida KT2440] [TssM]
ATGAAAACATTACTGCGTCTGTTGAAAAGTTTCTGGTTGCTGCTGCCATTGCTGTGGCTGGCTAGCCTGTTGATTTGCTG
GCTGGCCGCGCCGCTGGTGCCGTGGCTGCGTCATCACGTGCCTGAAGCGCTGGCAATCATCAGTGCCTGCTTCCTGCTGG
TAATCGTGCTGCGCCAATACCAGCGTATTCGCGCCGAACACAACCTGGAGAACCTGCTGCAGATCGAGGTCGACCGCTCG
TGGAATGCCACTGGCGAGTTCCGTGACCAGCAGGTGCTGCGTGAGCGCCTGAAGCACGCCATCACCATGCTGCGCACCGA
CCGCTCCGCCGGTGGCGGCGGCAAGGCGGCCCTGTCCGACCTGCCCTGGTACCTGGTGGTCGGCATGTCGGCGGCCGGCA
AGACCTCGCTGTTGACCCATTCCGGCCTGTCGGCCAGCATCGCTACGGCCAACGACAGTGAAAGCGGCACCCAGCACTGC
GACTGGTACTTCAGCCCCGACGCCGTGATGATCGACACCGCCGGGCGCTACCTGCGCGACGACCAATCGGCCAGCGAGTT
CTCGGCCTTTCTGCGCATGCTGCGTAAGCAGCGCGGCAAAGCGGCGATCAATGGCCTGGTCCTGGTGGTCAGCCTGCCCG
AACTGCTGGCGGCCAACAGCGATGAGCGCAATGCCCTGGCTGCCCAGCTGGTGGCCCGGGTGGAAGAATACGCCGAATGC
CTCGATGCCAACCCGCCGGTTTACCTGATGCTGAGCAAGACCGACCAGTTGCCGGGCTTCAGCCAGGCTTTCGACGGCCT
CGACCTGCACGAACGCCAGCAGCCGCTGGGCATGACCTTTGGCCTTTCGGAAATCCGCACCAACGGCCTGCACGCCGTGC
TGCAGACGCGCCTGAAGAAGCTGCAAGCTCATATTCGCCAGCACGTCGACGCGCAGATGATCGCCCTCGGTGCCGAAGCC
GACAGCACCCTGCTGAATTTCCCGCAGTACTTCGCCGCCCTCAGCGGTGTGCTCGAGCAATTCCTCGAACACTTCACCCG
CGGCCATCGCGGCGGTGCCCCGCTGCTGCTACGTGGCCTGTACTTCACCAGTGCACTGCAGAACGGGCAGCAACTGGGGC
AGGTCTATGAAGACGTCATCGCCGACGAATTCGCCCTGCAGGCCGCCTACGATGAACAGGCCGGGCACGTCGGCAAGGCC
CTGGGCAACCGCAGCTACTTCATCACCGACACTTTCCGCCAGGTGATCTTCCCCGACCGCGACCTGATCCTTTACCAGTC
GCGCCTGGGCCGCCAGGCTGCGTTCAGCCCGCTGCTACTGGGCCTGGCCGCCGCCACCGGGTTGCTGTTCATCGGTTGGC
AAGCGCTGTCGTTCGCCAATAACCGCCAGTGGCTGGACAGCCTGCGCGGGCAGCTGGCGCACATCGAACAGGCAGCAGAC
CGCGAGCAGCAGCTGGCCGCAGGCAAGGGCCTGGAAGTGCTGCGTGAGCAGATGGCCAACGTCAAGGCCCATCGCCTGCA
GGGAGTGCCCTTGCAGTTGGGTGGCGGCCTGTACCAGGGCGAGGCGATTCACCAGGTGACCCGCAGCGCCTACCTGGCGC
AGCTGCGCAGCCAGGCGCTGGAACCGATCGCACGCAGCCTGCAAGTGCAGATGCGGGCGTTCAATACCTTCGCCAACGGT
ATTAACCAGGAGCTGGAATTCACCCCGGCCCCGCAGCCGAAGAAGCGCAATGGCAAGCCGCTGGCCCCTGCCATTGCGGC
CAGGGCCAAGGCCGCGCTGGGCAACACCCGCGCTGGCGCCTATGCCGCCAAGGTCAACCTGGCCACTGCCAGCGATGGCG
CCGAGCTGTCCGCCGCCACCGGTGGGCTGTCACTGTCCGAAGAAATGCTCGGGCGCCTGGACGAGCAGCAGGTGGCCTCG
ATCATCGAGGCCTACAACACCCTCAAGCTGTACCTGTTGCTGACCGAGCCCCAGGCCCATCCAGACCCGGCCTTCGTCGC
TGCCAGCCTGCCCCAGGCCTGGGCCAGCGCCGCAGGCGAAGGCACCCCGGCCGACGCTGGCGTGATCGCAGAAAATGCCC
CGCTGTACGTGCAGTTGCTGGAGCAGGGCCAGGCGCCGTCGTTGCCGCGCAACGAACAGCTGATCAACGAAACCCGGCAG
AACCTCAAGTCGTTCATGATCTCCAGCTCGCTGGTCGATCGCGAATACCTGCGCCTGCAGCTCGAGTCGAGCCGGCAGTT
CCCGGCGCTGAGCCTCAACGACCTGGTCCCGCAACCAGGCCGCGCGCTGCTGTACGGAACCGCTGGTGTGCCGGCGATCT
ACACCCGCCAGGGCTGGGACACCTTCGTCAAGCCCGAGCTGATCAAGCTGGTGTCGGGCAACCTGCGCAACGAGTCGGAC
TGGGTGCTGGACGGCGAAGGCGGCGATGCCCTCGTGCAGAAGGCCAACTTCGTGCGCGAGTTCATGACCCGCTACAAGCG
CGACTACACCCAGGCCTGGTACAAGATGGTCAGCAGCGTTGGCGTGCGCCACTTCGCCGACCTGGCCTCGGCGACCCGGG
AGCTGGGGCTGTTGAGCGACGTACAGAACTCGCCAGTGAAGAACCTGCTGCAGGCGGTCAACGACAATACCCAGTGGGAC
CTGCCGGTCAAGCAGGCCATCCCGGCCCCAGGCACCAGCCGCGATGACGGTTTCTGGAGCAAGGTCACCGGTCTGTTCGA
CGCCAACGACACCCTGCCTGCCAACGTCGCCCCGGCCCTGCCGGCGGTGGACGACGGCAGCCTGGCCAAGCGCTTCGAGC
CGGTGGCGCGGGTGTTCGCCGAAAACAACGCCGAAGGCGCCGACAGCACCATCATGGATCGCTACCTGGCCGCCTTGCGC
AAACTCAAGGTGCGCATGAACAACATCCAGCGCTCGCAGGATGTGGGCAAGAGCAGCAAACAGTTGATCAGCGAGACCCT
GGAAGGCCAGCCGAGCGAGATCACCACCGTGCGCAACTACGTGGAAAGCAGCGTCGACACCAGCCAGGATGGCCTGTCGC
GCTCGCTGCAGGGGCTGTTCAGCCTGCCCATCCAGTATGCCTGGGCGACCCTGCGCGACCCGGCCGGCGAGCAGATCGCC
AAGGCCTGGGCGCAGCAGATCGCCAAGCCCTGGGAGCAGGTCATGGCACACCGTTACCCGATTGCCGGCAGCAGCCGCAA
CGAGGCTTCGGTGAAAGACCTGCAACGCTTCGTAGATCCCGACAGCGGCCTGCTGCCGGCCTTCAAACGCAACGAAATCG
GCAACTTGGCCGGTGGTGAAGGTCTGGGTGTAGGCGATGGCAAGGGGCCGGCGCTGGTCAACCCTGGCATGCTCAACAGC
ATCGACAAGGCCAGCTCCGTGGGCCAGGTGATCGCCAGCCTGTCAGACCGTGACAACGGCTTCGAAATCATGCTGGAGCC
TTCAGCCAACTTCACCGACATCGTCTTCACCCTCGATGGCCAGGAGCAGCACTACCGCAACGGCCGCAGCAGCTGGAACC
GCTTCGCCTGGCCGGGCACCAGCACCGCGCCGGGCGCGCGCCTGGACGTCGTCACCCTGAGCGGCACACGGGTCACCGTG
TTCGACTTCCCAGGGCGGTGGGGCCTGCTGCGCATGAATGAGAGCGCTCGGGTCGACGACCTGGACGGCATTCAGCAACG
CTTCAGCTGGAACACCGCCAGCGGCCGCGTAAGCCTTGTCGTGCGCAACTTCGGCGGGGTCAAGCTGACCGATCTGGGTG
ACGTCAAGGCCCTGAGCGCCCTCAACAGCAGGGGCGCGCAATGA