Detailed information of component protein


Summary

Component ID T6CP000096
Component protein type TssM
T6SS ID (Type) T6SS00014 experimental (Type i4b)
Strain Pseudomonas putida KT2440
Replicon chromosome
Sequence Protein sequence (832 a.a.); Nucleotide sequence (2496 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) PP_RS16000
Coordinate (Strand) 3478723..3481218 (-)
NCBI ID WP_010953988.1
RefSeq NC_002947
Uniprot ID A0A2V4FUU1_9PSED, Q88IA9_PSEPK
KEGG ID ppu:PP_3090
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
IcmF-related_N PF14331.8 6e-75 189..446
IcmF-related PF06761.14 1.2e-16 498..697
OmpA PF00691.22 3.6e-14 716..807

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Inside 1-12 MNKLKYYCLRYQ
Transmembrane helix 13-35 PYLLGVAFFLAIFLVWAIGRAFG
Outside 36-38 FAS
Transmembrane helix 39-61 LHSLLAGIGVFLLLSAGYVLLLY
Inside 62-442 RGVGQHHNLEGLLRDDADQAVLSAAPADREEVSLLRERLLQGIERLHSNKPRGTSNKDALYALPWYLVIGQPAAGKSTMILQSGLNFPYAEREGVRVAGLGGTRNCDWFFSSEAVLLDTAGRYMNSPEEAGKWRGFLQLLRQHRQRRPLNGLIVSVSIADILHGSVEDQERVAKRLRERIQESCALLEVRLPIYLVFTKCDLIPGFTAFYRQLDDAARGEVMGKTFSHKGYEQADWGQRFSNAMDELTRYWGQMASQQLVQQDIQVTRRNDAAYRFPLELAALKPRLHQFVDSLLRANPYQNAEMLRGFYFTAALQADEAQWGCHGQHVAERFALEHAEGTGTAGSQPAPLFINSLFRKVIIPDQHLVALYTSNHRERRRK
Transmembrane helix 443-465 AGWVGAAGLAALVLCSLWGWSYL
Outside 466-831 NNRATLASIADELAQAKADDQAASGQYTAWRSLDRLRFWAAHYHEQHHAKGVPLGMRLGLYQGHEVEPLLRDRYFATLQNVMLKPTADNLTRTLYLLTTLKVYQRNTRELQPVSGIDSVEAEALPHDNRAQSIANFGKAALDTYVMLSPGQREHADPAFLKAHLPDYWYPAIARQTGKSMAAAGSEAGGNQDYLYASRQITFYSDQIREPDVPRILDNAFLMSSSRNYIDSLRAQSLRAIETITLESDTLFAFGRADFQSLKNEGQHQLSAIASKLLNTPNIGKIIISGHADQLGDSQGNLQVSKQRAQTIRTYLVGKGVPAELVVAQGEGSRKPLVNCDMQQPRTQLIKCLEPNRRVEIEVRGLN



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9898 - -



  Protein sequence: 832 a.a.    

>T6CP000096 NC_002947:c3481218-3478723 [Pseudomonas putida KT2440] [TssM]
MNKLKYYCLRYQPYLLGVAFFLAIFLVWAIGRAFGFASLHSLLAGIGVFLLLSAGYVLLLYRGVGQHHNLEGLLRDDADQ
AVLSAAPADREEVSLLRERLLQGIERLHSNKPRGTSNKDALYALPWYLVIGQPAAGKSTMILQSGLNFPYAEREGVRVAG
LGGTRNCDWFFSSEAVLLDTAGRYMNSPEEAGKWRGFLQLLRQHRQRRPLNGLIVSVSIADILHGSVEDQERVAKRLRER
IQESCALLEVRLPIYLVFTKCDLIPGFTAFYRQLDDAARGEVMGKTFSHKGYEQADWGQRFSNAMDELTRYWGQMASQQL
VQQDIQVTRRNDAAYRFPLELAALKPRLHQFVDSLLRANPYQNAEMLRGFYFTAALQADEAQWGCHGQHVAERFALEHAE
GTGTAGSQPAPLFINSLFRKVIIPDQHLVALYTSNHRERRRKAGWVGAAGLAALVLCSLWGWSYLNNRATLASIADELAQ
AKADDQAASGQYTAWRSLDRLRFWAAHYHEQHHAKGVPLGMRLGLYQGHEVEPLLRDRYFATLQNVMLKPTADNLTRTLY
LLTTLKVYQRNTRELQPVSGIDSVEAEALPHDNRAQSIANFGKAALDTYVMLSPGQREHADPAFLKAHLPDYWYPAIARQ
TGKSMAAAGSEAGGNQDYLYASRQITFYSDQIREPDVPRILDNAFLMSSSRNYIDSLRAQSLRAIETITLESDTLFAFGR
ADFQSLKNEGQHQLSAIASKLLNTPNIGKIIISGHADQLGDSQGNLQVSKQRAQTIRTYLVGKGVPAELVVAQGEGSRKP
LVNCDMQQPRTQLIKCLEPNRRVEIEVRGLN*

  Nucleotide sequence: 2496 bp    

>T6CP000096 NC_002947:c3481218-3478723 [Pseudomonas putida KT2440] [TssM]
ATGAACAAGCTCAAGTACTACTGCCTGCGCTACCAACCCTACCTGCTGGGCGTGGCGTTCTTCCTGGCGATCTTCCTGGT
CTGGGCCATCGGCCGCGCCTTCGGCTTCGCCTCGCTGCACAGCCTGCTGGCCGGGATCGGTGTGTTTCTGCTGCTGTCGG
CGGGCTATGTACTGCTGCTGTACCGCGGCGTGGGTCAGCACCACAACCTTGAAGGCCTGCTGCGCGACGACGCCGACCAG
GCCGTACTCAGTGCAGCCCCGGCCGACCGGGAAGAAGTCAGCCTGTTGCGCGAGCGCCTGCTGCAGGGCATCGAGCGCCT
GCACAGCAACAAGCCGCGCGGTACTTCGAACAAGGATGCCCTGTATGCCCTGCCCTGGTACCTGGTCATTGGCCAGCCTG
CCGCCGGCAAGAGCACGATGATACTGCAGTCGGGCCTGAACTTCCCCTATGCCGAGCGCGAAGGCGTGCGGGTCGCGGGC
CTGGGCGGCACGCGCAACTGCGACTGGTTCTTCAGCTCTGAAGCGGTACTGCTGGACACTGCCGGGCGTTACATGAACAG
CCCCGAGGAAGCCGGCAAGTGGCGCGGCTTTTTGCAACTGCTGCGCCAGCACCGCCAGCGCCGTCCCCTTAACGGCTTGA
TCGTCAGCGTCAGCATCGCCGATATTCTGCATGGCTCGGTCGAAGACCAGGAGCGCGTGGCCAAGCGCCTGCGCGAACGC
ATTCAGGAAAGCTGCGCGCTGCTTGAAGTGCGCCTGCCAATCTACCTGGTTTTCACCAAGTGCGACCTGATCCCTGGTTT
CACCGCGTTCTATCGCCAGCTGGACGACGCCGCGCGTGGTGAAGTGATGGGTAAAACCTTCTCTCACAAGGGGTACGAGC
AAGCCGACTGGGGCCAACGCTTCAGCAATGCGATGGACGAGCTGACGCGTTACTGGGGGCAGATGGCGAGCCAGCAGCTG
GTGCAGCAGGACATACAAGTCACCCGGCGGAACGACGCTGCCTACCGCTTCCCGCTGGAGCTGGCCGCGCTCAAGCCGCG
CCTGCATCAGTTCGTCGACAGCCTGCTGCGTGCCAACCCTTACCAGAATGCCGAAATGCTGCGCGGTTTCTATTTCACCG
CGGCGCTGCAGGCCGACGAGGCTCAGTGGGGCTGCCACGGCCAGCATGTGGCCGAACGCTTCGCGCTCGAACACGCAGAA
GGTACGGGCACTGCCGGCAGCCAGCCGGCGCCGCTGTTCATCAACAGCCTGTTCCGCAAAGTGATCATTCCCGACCAGCA
TTTGGTGGCGCTGTACACCAGCAACCACCGTGAACGCCGGCGCAAGGCCGGGTGGGTGGGCGCCGCCGGCCTGGCGGCAC
TGGTGCTGTGCAGCCTGTGGGGCTGGTCGTACCTGAACAACCGCGCCACCCTGGCCAGCATTGCCGACGAACTGGCCCAG
GCCAAGGCCGACGACCAGGCGGCCAGCGGCCAGTACACCGCCTGGCGAAGCCTCGACCGCTTGCGCTTCTGGGCTGCTCA
CTACCATGAGCAACACCACGCTAAGGGCGTGCCCCTCGGCATGCGCCTGGGCCTGTACCAGGGCCATGAGGTCGAGCCGC
TGCTGCGCGACCGCTACTTCGCCACGTTGCAGAACGTGATGCTAAAGCCCACGGCCGATAATCTGACCCGCACCCTGTAC
CTGCTGACCACGCTCAAGGTCTACCAGCGCAACACCCGTGAGCTGCAGCCAGTGAGCGGCATTGACAGCGTAGAGGCCGA
GGCGCTGCCCCATGACAACCGCGCCCAGTCGATCGCCAATTTCGGAAAGGCGGCCCTGGACACTTACGTGATGCTTTCTC
CGGGCCAGCGCGAGCATGCCGACCCGGCGTTTCTCAAGGCGCACCTGCCGGACTACTGGTACCCGGCCATCGCCCGCCAG
ACCGGCAAGAGCATGGCCGCCGCTGGCAGCGAGGCCGGTGGCAACCAGGACTACCTGTATGCCAGCCGCCAGATCACGTT
CTATAGCGACCAGATCCGTGAGCCAGATGTACCGCGCATCCTCGACAACGCCTTCCTGATGTCCAGTTCGCGCAACTACA
TCGACAGCCTGCGGGCCCAGTCACTGCGTGCGATCGAGACCATCACGCTGGAATCCGACACCCTGTTCGCCTTCGGCCGC
GCCGATTTCCAGAGCCTGAAAAACGAAGGCCAGCATCAGCTGAGCGCAATTGCCAGCAAGCTGCTGAACACCCCGAATAT
CGGCAAGATCATCATCTCGGGGCACGCCGACCAACTGGGTGACAGCCAGGGCAACCTGCAGGTTTCGAAACAACGGGCGC
AAACCATCCGCACCTATCTGGTTGGCAAGGGCGTACCTGCCGAGCTGGTGGTCGCGCAGGGCGAAGGCAGCCGCAAGCCA
TTGGTCAACTGCGACATGCAACAACCGCGAACGCAGTTGATCAAGTGCCTGGAGCCCAACCGCCGGGTGGAAATCGAAGT
GCGTGGGCTTAACTGA