Detailed information of accessory protein


Summary

Accessory protein ID ACP00041 experimental
Type adaptor
Related T6SS (Type) -
Strain Vibrio cholerae 1587
Replicon chromosome
Related structure protein VgrG-1
Related effector TseL
Description Tap-1, DUF4124 domain-containing protein
Reference [1] Unterweger D, Kostiuk B, Ă–tjengerdes R, et al. Chimeric adaptor proteins translocate diverse type VI secretion system effectors in Vibrio cholerae. EMBO J. 2015 Aug 13;34(16):2198-210. doi: 10.15252/embj.201591163. Epub 2015 Jul 19. PMID: 26194724
experimental Experimental investigation has been performed.
insolico Bioinformatics investigation has been performed

External database links

Locus tag (Gene) A55_1501 (tap-2)
Coordinates (Strand) 235783..236571 (+)
NCBI ID 446538621
RefSeq NZ_KQ410627
Uniprot ID -
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
DUF4123 PF13503.8 1e-17 14..125

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-262 MIQQWLMEQKTPTFWLLDQQAFKCVIAANNGIGFDGTQILFHGETFAPVMSLSPWLIPVSDKVLELSDELLQQGIFLTSHSSTSELLSHLQSLLIAALEGEEVLFRFYDRQVIVPMLDAMRDLERNDFLGPVEKLAILKQGIFQEWVNTRSSEFIYQPAPWWKIQPYHLMPLYRTEVHAQVLERRFWEKLPYVMEQLDEPQQWIKTILDEAKQANLGHDNAEYLVLNHLWKASLTTLEQMSDALHLNQQELQEIMQIREKLA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9938 - -



  Protein sequence: 263 a.a.    

>ACP00041 NZ_KQ410627:235783-236571 [Vibrio cholerae 1587]
MIQQWLMEQKTPTFWLLDQQAFKCVIAANNGIGFDGTQILFHGETFAPVMSLSPWLIPVSDKVLELSDELLQQGIFLTSH
SSTSELLSHLQSLLIAALEGEEVLFRFYDRQVIVPMLDAMRDLERNDFLGPVEKLAILKQGIFQEWVNTRSSEFIYQPAP
WWKIQPYHLMPLYRTEVHAQVLERRFWEKLPYVMEQLDEPQQWIKTILDEAKQANLGHDNAEYLVLNHLWKASLTTLEQM
SDALHLNQQELQEIMQIREKLA*

  Nucleotide sequence: 789 bp    

>ACP00041 NZ_KQ410627:235783-236571 [Vibrio cholerae 1587]
ATGATTCAGCAGTGGCTAATGGAGCAAAAAACACCCACCTTCTGGTTATTAGATCAACAAGCTTTTAAATGCGTCATCGC
AGCGAATAACGGAATAGGATTTGACGGTACTCAGATTCTATTTCACGGCGAGACATTTGCTCCTGTGATGAGTTTGTCTC
CTTGGTTAATTCCTGTCTCCGACAAGGTGCTGGAATTGTCGGATGAGCTGTTACAGCAAGGTATTTTCTTAACCAGTCAT
AGTTCTACAAGTGAATTATTAAGCCATCTCCAAAGCCTTTTGATTGCAGCACTGGAAGGCGAAGAAGTACTGTTTCGTTT
TTATGATAGGCAGGTCATTGTGCCTATGTTGGATGCGATGCGAGATCTGGAACGTAACGATTTTTTAGGGCCGGTAGAGA
AATTAGCCATCCTTAAACAAGGAATATTTCAAGAATGGGTAAATACGCGTAGTTCCGAGTTTATCTATCAGCCTGCACCT
TGGTGGAAAATACAGCCTTATCATTTGATGCCACTTTATCGAACTGAAGTGCATGCCCAAGTTTTAGAACGACGTTTTTG
GGAAAAGCTTCCTTACGTAATGGAACAGCTTGATGAGCCACAACAATGGATTAAAACCATTTTAGATGAAGCTAAGCAGG
CTAATTTGGGGCACGATAATGCAGAGTACTTAGTTTTAAATCACTTGTGGAAAGCCTCATTAACCACTCTAGAGCAGATG
AGTGATGCTCTTCATCTTAATCAACAAGAACTTCAGGAAATAATGCAAATTCGGGAGAAATTAGCATGA