Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   AAHT65_RS19745 Genome accession   NZ_CP154443
Coordinates   3931186..3931560 (-) Length   124 a.a.
NCBI ID   WP_106270999.1    Uniprot ID   -
Organism   Bacillus atrophaeus strain SW     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 3926186..3936560
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAHT65_RS19705 (AAHT65_19700) - 3926482..3927276 (+) 795 WP_094232411.1 YqhG family protein -
  AAHT65_RS19710 (AAHT65_19705) sinI 3927466..3927639 (+) 174 WP_094232412.1 anti-repressor SinI Regulator
  AAHT65_RS19715 (AAHT65_19710) sinR 3927673..3928008 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  AAHT65_RS19720 (AAHT65_19715) - 3928202..3928984 (-) 783 WP_063638541.1 biofilm matrix protein TasA -
  AAHT65_RS19725 (AAHT65_19720) - 3929048..3929620 (-) 573 WP_010789195.1 signal peptidase I SipW -
  AAHT65_RS19730 (AAHT65_19725) tapA 3929604..3930305 (-) 702 WP_343310698.1 amyloid fiber anchoring/assembly protein TapA -
  AAHT65_RS19735 (AAHT65_19730) - 3930567..3930890 (+) 324 WP_106271001.1 DUF3889 domain-containing protein -
  AAHT65_RS19740 (AAHT65_19735) - 3930937..3931116 (-) 180 WP_003325435.1 YqzE family protein -
  AAHT65_RS19745 (AAHT65_19740) comGG 3931186..3931560 (-) 375 WP_106270999.1 competence type IV pilus minor pilin ComGG Machinery gene
  AAHT65_RS19750 (AAHT65_19745) comGF 3931561..3932067 (-) 507 WP_274379311.1 competence type IV pilus minor pilin ComGF -
  AAHT65_RS19755 (AAHT65_19750) comGE 3931970..3932317 (-) 348 WP_003325432.1 competence type IV pilus minor pilin ComGE Machinery gene
  AAHT65_RS19760 (AAHT65_19755) comGD 3932301..3932741 (-) 441 WP_343310699.1 competence type IV pilus minor pilin ComGD Machinery gene
  AAHT65_RS19765 (AAHT65_19760) comGC 3932731..3933039 (-) 309 WP_087941811.1 competence type IV pilus major pilin ComGC Machinery gene
  AAHT65_RS19770 (AAHT65_19765) comGB 3933045..3934082 (-) 1038 WP_106270998.1 competence type IV pilus assembly protein ComGB Machinery gene
  AAHT65_RS19775 (AAHT65_19770) comGA 3934069..3935139 (-) 1071 WP_088117573.1 competence type IV pilus ATPase ComGA Machinery gene
  AAHT65_RS19780 (AAHT65_19775) - 3935519..3936472 (-) 954 WP_088117575.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14301.48 Da        Isoelectric Point: 10.0971

>NTDB_id=993460 AAHT65_RS19745 WP_106270999.1 3931186..3931560(-) (comGG) [Bacillus atrophaeus strain SW]
MSRSKGFIYPAVLFAAAVILLVVGYTSSEYITRKTFEKETKEFYIRENLLQNGALLSIRHILEGRQGLKGSRQFEYGLVS
YQIQSTSKKEQKEINVKSVTNSGSEMTARFIFDLKQKKVIHWEE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=993460 AAHT65_RS19745 WP_106270999.1 3931186..3931560(-) (comGG) [Bacillus atrophaeus strain SW]
ATGTCACGGTCGAAAGGCTTTATTTATCCTGCTGTGCTTTTTGCAGCAGCTGTTATTTTGCTCGTTGTCGGTTATACATC
GTCGGAATATATCACCCGTAAAACATTTGAAAAGGAGACCAAAGAATTTTACATCAGGGAAAATTTACTGCAAAATGGCG
CACTTCTATCCATTCGTCATATACTTGAGGGCCGTCAAGGACTAAAAGGCTCACGGCAATTTGAATATGGGCTGGTGTCT
TATCAAATTCAAAGCACATCAAAAAAAGAGCAAAAAGAGATCAATGTAAAATCTGTCACGAATTCAGGCTCGGAAATGAC
CGCCCGGTTCATATTTGATTTGAAACAAAAAAAAGTTATTCATTGGGAAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

61.29

100

0.613

Multiple sequence alignment