Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   AAHT65_RS19710 Genome accession   NZ_CP154443
Coordinates   3927466..3927639 (+) Length   57 a.a.
NCBI ID   WP_094232412.1    Uniprot ID   -
Organism   Bacillus atrophaeus strain SW     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 3922466..3932639
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAHT65_RS19695 (AAHT65_19690) gcvT 3923236..3924330 (-) 1095 WP_343310696.1 glycine cleavage system aminomethyltransferase GcvT -
  AAHT65_RS19700 (AAHT65_19695) - 3924791..3926461 (+) 1671 WP_343310697.1 SNF2-related protein -
  AAHT65_RS19705 (AAHT65_19700) - 3926482..3927276 (+) 795 WP_094232411.1 YqhG family protein -
  AAHT65_RS19710 (AAHT65_19705) sinI 3927466..3927639 (+) 174 WP_094232412.1 anti-repressor SinI Regulator
  AAHT65_RS19715 (AAHT65_19710) sinR 3927673..3928008 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  AAHT65_RS19720 (AAHT65_19715) - 3928202..3928984 (-) 783 WP_063638541.1 biofilm matrix protein TasA -
  AAHT65_RS19725 (AAHT65_19720) - 3929048..3929620 (-) 573 WP_010789195.1 signal peptidase I SipW -
  AAHT65_RS19730 (AAHT65_19725) tapA 3929604..3930305 (-) 702 WP_343310698.1 amyloid fiber anchoring/assembly protein TapA -
  AAHT65_RS19735 (AAHT65_19730) - 3930567..3930890 (+) 324 WP_106271001.1 DUF3889 domain-containing protein -
  AAHT65_RS19740 (AAHT65_19735) - 3930937..3931116 (-) 180 WP_003325435.1 YqzE family protein -
  AAHT65_RS19745 (AAHT65_19740) comGG 3931186..3931560 (-) 375 WP_106270999.1 competence type IV pilus minor pilin ComGG Machinery gene
  AAHT65_RS19750 (AAHT65_19745) comGF 3931561..3932067 (-) 507 WP_274379311.1 competence type IV pilus minor pilin ComGF -
  AAHT65_RS19755 (AAHT65_19750) comGE 3931970..3932317 (-) 348 WP_003325432.1 competence type IV pilus minor pilin ComGE Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6817.90 Da        Isoelectric Point: 10.4757

>NTDB_id=993458 AAHT65_RS19710 WP_094232412.1 3927466..3927639(+) (sinI) [Bacillus atrophaeus strain SW]
MKNAKKEFLELDQEWVELMKRAREANINPEEIRKYLNLHKKSARPVPATRSHTINPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=993458 AAHT65_RS19710 WP_094232412.1 3927466..3927639(+) (sinI) [Bacillus atrophaeus strain SW]
ATGAAAAATGCAAAAAAAGAGTTTTTAGAATTAGATCAAGAATGGGTTGAATTAATGAAAAGAGCCAGAGAAGCAAATAT
CAACCCGGAGGAGATACGCAAATATTTAAATTTGCATAAAAAGTCTGCTCGTCCTGTCCCAGCCACCAGAAGTCATACCA
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

77.193

100

0.772

Multiple sequence alignment