Detailed information NTG0098925

Bioinformatically predicted

Overview

• Name: comGG/cglG
• Type: Machinery gene
• Locus tag: R8570_RS09825
• Genome accession: NZ_AP026932
• Coordinates: 1927197..1927610 (-)
• Length: 137 a.a.
• NCBI ID: WP_000265617.1
• Uniprot ID: A0A064C498
• Organism: Streptococcus pneumoniae strain PZ900701549
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1922197..1932610

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
R8570_RS09800 (PC1528_19320)	-	1922900..1923724 (-)	825	WP_201417363.1	membrane protein insertase YidC	-
R8570_RS09805 (PC1528_19330)	rnpA	1923699..1924070 (-)	372	WP_000739246.1	ribonuclease P protein component	-
R8570_RS09810 (PC1528_19340)	-	1924218..1925408 (-)	1191	WP_000167755.1	acetate kinase	-
R8570_RS09815 (PC1528_19350)	comYH	1925459..1926412 (-)	954	WP_000345086.1	class I SAM-dependent methyltransferase	Machinery gene
R8570_RS09820	-	1926473..1927060 (-)	588	Protein_1910	class I SAM-dependent methyltransferase	-
R8570_RS09825 (PC1528_19380)	comGG/cglG	1927197..1927610 (-)	414	WP_000265617.1	competence type IV pilus minor pilin ComGG	Machinery gene
R8570_RS09830 (PC1528_19390)	comGF/cglF	1927588..1928049 (-)	462	WP_000250529.1	competence type IV pilus minor pilin ComGF	Machinery gene
R8570_RS09835 (PC1528_19400)	comGE/cglE	1928012..1928314 (-)	303	WP_000413382.1	competence type IV pilus minor pilin ComGE	Machinery gene
R8570_RS09840 (PC1528_19410)	comGD/cglD	1928277..1928681 (-)	405	WP_000588002.1	competence type IV pilus minor pilin ComGD	Machinery gene
R8570_RS09845 (PC1528_19420)	comGC/cglC	1928674..1929000 (-)	327	WP_000738623.1	comG operon protein ComGC	Machinery gene
R8570_RS09850 (PC1528_19430)	comGB/cglB	1929002..1930018 (-)	1017	WP_077141332.1	competence type IV pilus assembly protein ComGB	Machinery gene
R8570_RS09855 (PC1528_19440)	comGA/cglA/cilD	1929966..1930907 (-)	942	WP_000249550.1	competence type IV pilus ATPase ComGA	Machinery gene
R8570_RS09860 (PC1528_19450)	-	1930983..1931348 (-)	366	WP_000286415.1	DUF1033 family protein	-
R8570_RS09865 (PC1528_19460)	-	1931499..1932557 (-)	1059	WP_000649468.1	zinc-dependent alcohol dehydrogenase family protein	-

Sequence

Protein

• Length: 137 a.a.
• Molecular weight: 15888.33 Da
• Isoelectric Point: 10.2476

>NTDB_id=98925 R8570_RS09825 WP_000265617.1 1927197..1927610(-) (comGG/cglG) [Streptococcus pneumoniae strain PZ900701549]
MWKKKKVKAGVLLYAVTIAAIFSLLLQFYLNRQIAHYQDYALNKEKLVAFAMAKRTKDKAEQESGEQVFNLGQVSYQNKK
TSLVTTVRTSKSQYEFLFPSVKIKEEKRDKKEEVATDSSEKVEKKKSEEKPEKKENS

Nucleotide

• Length: 414 bp

>NTDB_id=98925 R8570_RS09825 WP_000265617.1 1927197..1927610(-) (comGG/cglG) [Streptococcus pneumoniae strain PZ900701549]
GTGTGGAAAAAGAAGAAAGTTAAGGCAGGTGTTCTCCTCTACGCAGTCACCATAGCAGCCATCTTTAGTCTTTTGTTGCA
ATTTTATTTGAACCGACAAATCGCCCACTATCAAGACTATGCTTTAAATAAAGAAAAATTGGTTGCTTTTGCCATGGCTA
AACGAACCAAGGATAAAGCCGAGCAAGAAAGTGGGGAACAGGTCTTTAATCTAGGTCAGGTAAGCTATCAAAACAAGAAA
ACAAGCTTGGTGACGACTGTTCGTACGTCTAAGAGCCAATATGAGTTTCTGTTTCCTTCAGTCAAAATCAAAGAAGAGAA
AAGAGATAAAAAGGAAGAGGTAGCGACCGATTCAAGCGAAAAAGTGGAGAAGAAAAAATCAGAAGAGAAGCCTGAAAAGA
AAGAGAATTCCTAG

Domains

No domain identified.

3D structure

• AlphaFold DB: A0A064C498

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGG/cglG	Streptococcus pneumoniae TIGR4	94.872	85.401	0.81
comGG/cglG	Streptococcus pneumoniae Rx1	94.872	85.401	0.81
comGG/cglG	Streptococcus pneumoniae D39	94.872	85.401	0.81
comGG/cglG	Streptococcus pneumoniae R6	94.872	85.401	0.81
comGG/cglG	Streptococcus mitis NCTC 12261	89.256	88.321	0.788
comGG/cglG	Streptococcus mitis SK321	85.95	88.321	0.759
comYG	Streptococcus mutans UA140	38.06	97.81	0.372
comYG	Streptococcus mutans UA159	38.06	97.81	0.372