Detailed information    

insolico Bioinformatically predicted

Overview


Name   comW   Type   Regulator
Locus tag   R8635_RS00110 Genome accession   NZ_AP026924
Coordinates   21282..21518 (+) Length   78 a.a.
NCBI ID   WP_000939545.1    Uniprot ID   -
Organism   Streptococcus pneumoniae strain PZ900700063     
Function   stabilization and activation of ComX (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 12174..93094 21282..21518 within 0
IS/Tn 20765..20965 21282..21518 flank 317


Gene organization within MGE regions


Location: 12174..93094
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R8635_RS00065 (PC0062_00130) ftsH 12174..14132 (+) 1959 WP_000744557.1 ATP-dependent zinc metalloprotease FtsH -
  R8635_RS00070 (PC0062_00140) comX/comX2 14254..14733 (+) 480 WP_000588873.1 sigma-70 family RNA polymerase sigma factor Regulator
  R8635_RS00105 - 20235..21016 (-) 782 Protein_14 transposase -
  R8635_RS00110 (PC0062_00160) comW 21282..21518 (+) 237 WP_000939545.1 sigma(X)-activator ComW Regulator
  R8635_RS00115 (PC0062_00170) - 21749..23035 (+) 1287 WP_000205044.1 adenylosuccinate synthase -
  R8635_RS00120 (PC0062_00180) tadA 23236..23703 (+) 468 WP_000291870.1 tRNA adenosine(34) deaminase TadA -
  R8635_RS00130 (PC0062_00190) - 23912..25048 (-) 1137 WP_224757251.1 site-specific integrase -
  R8635_RS00135 (PC0062_00200) - 25173..25523 (-) 351 WP_001020945.1 hypothetical protein -
  R8635_RS00140 (PC0062_00210) - 25537..25917 (-) 381 WP_000136430.1 ImmA/IrrE family metallo-endopeptidase -
  R8635_RS00145 (PC0062_00220) - 25939..26295 (-) 357 WP_000153672.1 helix-turn-helix domain-containing protein -
  R8635_RS00150 (PC0062_00230) - 26571..26756 (+) 186 WP_000638668.1 helix-turn-helix transcriptional regulator -
  R8635_RS00155 (PC0062_00240) - 26758..27474 (+) 717 WP_001004042.1 phage antirepressor KilAC domain-containing protein -
  R8635_RS00160 (PC0062_00250) - 27521..27787 (+) 267 WP_001865194.1 hypothetical protein -
  R8635_RS00165 (PC0062_00270) - 28135..28398 (+) 264 WP_001814284.1 transcriptional regulator -
  R8635_RS00170 (PC0062_00280) - 28630..28896 (+) 267 WP_000450965.1 hypothetical protein -
  R8635_RS00175 (PC0062_00290) - 28980..29432 (+) 453 WP_055310816.1 hypothetical protein -
  R8635_RS00180 (PC0062_00300) - 29438..30085 (+) 648 WP_023396071.1 ERF family protein -
  R8635_RS00185 (PC0062_00310) - 30088..31080 (+) 993 WP_075223585.1 DUF1351 domain-containing protein -
  R8635_RS00190 (PC0062_00320) - 31102..31278 (+) 177 WP_001203349.1 hypothetical protein -
  R8635_RS00195 (PC0062_00330) ssb 31268..31843 (+) 576 WP_050149695.1 single-stranded DNA-binding protein Machinery gene
  R8635_RS00200 (PC0062_00340) - 31857..32177 (+) 321 WP_224757151.1 hypothetical protein -
  R8635_RS00205 (PC0062_00350) - 32192..32395 (+) 204 WP_000161126.1 hypothetical protein -
  R8635_RS00210 (PC0062_00360) - 32423..32602 (+) 180 Protein_34 hypothetical protein -
  R8635_RS00215 (PC0062_00370) - 32619..32831 (+) 213 WP_001286809.1 crAss001_48 related protein -
  R8635_RS00220 (PC0062_00380) - 32842..33243 (+) 402 WP_000667209.1 hypothetical protein -
  R8635_RS00225 (PC0062_00390) - 33245..33451 (+) 207 WP_075223584.1 hypothetical protein -
  R8635_RS00230 (PC0062_00400) - 33500..33817 (+) 318 WP_000969685.1 hypothetical protein -
  R8635_RS00235 (PC0062_00410) - 33819..34334 (+) 516 WP_001021768.1 DUF1642 domain-containing protein -
  R8635_RS00240 (PC0062_00420) - 34335..34547 (+) 213 WP_000160161.1 hypothetical protein -
  R8635_RS00245 (PC0062_00430) - 34544..34915 (+) 372 WP_001247149.1 hypothetical protein -
  R8635_RS00250 (PC0062_00440) - 34936..35229 (+) 294 WP_000194856.1 hypothetical protein -
  R8635_RS00255 (PC0062_00450) - 35229..35621 (+) 393 WP_000162611.1 hypothetical protein -
  R8635_RS00260 (PC0062_00460) - 35687..36781 (+) 1095 WP_000425573.1 DUF4417 domain-containing protein -
  R8635_RS00265 (PC0062_00470) - 36762..37508 (+) 747 WP_000057535.1 hypothetical protein -
  R8635_RS00270 (PC0062_00480) - 37712..38167 (+) 456 WP_001136855.1 KGG domain-containing protein -
  R8635_RS00275 (PC0062_00490) - 38157..39467 (+) 1311 WP_050085301.1 PBSX family phage terminase large subunit -
  R8635_RS00280 (PC0062_00500) - 39480..41048 (+) 1569 WP_024475368.1 phage portal protein -
  R8635_RS00285 (PC0062_00510) - 41035..41208 (+) 174 WP_000169861.1 hypothetical protein -
  R8635_RS00290 (PC0062_00520) - 41251..42402 (+) 1152 WP_000730219.1 phage minor capsid protein -
  R8635_RS00295 (PC0062_00530) - 42541..43104 (+) 564 WP_050222512.1 phage scaffolding protein -
  R8635_RS00300 (PC0062_00540) - 43122..44003 (+) 882 WP_001139820.1 hypothetical protein -
  R8635_RS00305 (PC0062_00550) - 44014..44247 (+) 234 WP_001240344.1 hypothetical protein -
  R8635_RS00310 (PC0062_00560) - 44290..44682 (+) 393 WP_000221836.1 hypothetical protein -
  R8635_RS00315 (PC0062_00570) - 44672..45043 (+) 372 WP_000565934.1 putative minor capsid protein -
  R8635_RS00320 (PC0062_00580) - 45043..45387 (+) 345 WP_000020371.1 minor capsid protein -
  R8635_RS00325 (PC0062_00590) - 45387..45794 (+) 408 WP_001208881.1 minor capsid protein -
  R8635_RS00330 (PC0062_00600) - 45791..46240 (+) 450 WP_050198117.1 phage tail tube protein -
  R8635_RS00335 (PC0062_00610) - 46305..46793 (+) 489 WP_050216326.1 hypothetical protein -
  R8635_RS00340 (PC0062_00620) - 46806..47375 (+) 570 WP_000062048.1 Gp15 family bacteriophage protein -
  R8635_RS00345 (PC0062_00630) - 47368..50649 (+) 3282 WP_075223583.1 tape measure protein -
  R8635_RS00350 (PC0062_00640) - 50646..52160 (+) 1515 WP_050221514.1 distal tail protein Dit -
  R8635_RS00355 (PC0062_00650) - 52162..59334 (+) 7173 WP_317657546.1 phage tail protein -
  R8635_RS00360 (PC0062_00660) - 59346..61394 (+) 2049 WP_075223615.1 DUF859 family phage minor structural protein -
  R8635_RS00365 (PC0062_00670) - 61454..61717 (+) 264 WP_000922101.1 hypothetical protein -
  R8635_RS00370 (PC0062_00680) - 61727..62143 (+) 417 WP_000687457.1 phage holin family protein -
  R8635_RS00375 (PC0062_00690) - 62147..62482 (+) 336 WP_075223614.1 phage holin -
  R8635_RS00380 (PC0062_00700) - 62485..63441 (+) 957 WP_075223617.1 N-acetylmuramoyl-L-alanine amidase family protein -
  R8635_RS00385 (PC0062_00710) - 63724..64167 (+) 444 WP_000701992.1 dUTP diphosphatase -
  R8635_RS00390 (PC0062_00720) - 64169..64684 (+) 516 WP_317657561.1 histidine phosphatase family protein -
  R8635_RS00395 (PC0062_00730) radA 64698..66059 (+) 1362 WP_074017595.1 DNA repair protein RadA Machinery gene
  R8635_RS00400 (PC0062_00740) - 66132..66629 (+) 498 WP_001809263.1 carbonic anhydrase -
  R8635_RS00405 (PC0062_00750) - 66654..67468 (+) 815 Protein_73 PrsW family intramembrane metalloprotease -
  R8635_RS00410 (PC0062_00760) - 67613..68581 (+) 969 WP_000010163.1 ribose-phosphate diphosphokinase -
  R8635_RS00415 - 68715..68996 (-) 282 Protein_75 ISL3 family transposase -
  R8635_RS00420 - 69123..70030 (-) 908 Protein_76 Rpn family recombination-promoting nuclease/putative transposase -
  R8635_RS00425 (PC0062_00800) polA 70281..72914 (+) 2634 WP_061459569.1 DNA polymerase I -
  R8635_RS00430 (PC0062_00810) - 72999..73436 (+) 438 WP_000076479.1 CoA-binding protein -
  R8635_RS00435 - 73477..73647 (+) 171 WP_256948191.1 hypothetical protein -
  R8635_RS00440 (PC0062_00820) - 73666..74676 (-) 1011 WP_050203163.1 YeiH family protein -
  R8635_RS00445 (PC0062_00830) - 74825..75994 (+) 1170 WP_000366342.1 pyridoxal phosphate-dependent aminotransferase -
  R8635_RS00450 (PC0062_00840) recO 75991..76761 (+) 771 WP_000616164.1 DNA repair protein RecO -
  R8635_RS00455 (PC0062_00850) plsX 76758..77750 (+) 993 WP_000717458.1 phosphate acyltransferase PlsX -
  R8635_RS00460 (PC0062_00860) - 77756..77989 (+) 234 WP_000136447.1 acyl carrier protein -
  R8635_RS00465 - 78026..78326 (+) 301 Protein_85 transposase family protein -
  R8635_RS00470 (PC0062_00870) blpU 78529..78759 (+) 231 WP_001093075.1 bacteriocin-like peptide BlpU -
  R8635_RS00475 - 78762..78887 (+) 126 WP_000346297.1 PncF family bacteriocin immunity protein -
  R8635_RS00480 (PC0062_00880) comA 79474..81627 (+) 2154 WP_268217970.1 peptide cleavage/export ABC transporter ComA Regulator
  R8635_RS00485 (PC0062_00890) comB 81640..82989 (+) 1350 WP_000801620.1 competence pheromone export protein ComB Regulator
  R8635_RS00490 (PC0062_00900) purC 83159..83866 (+) 708 WP_000043300.1 phosphoribosylaminoimidazolesuccinocarboxamide synthase -
  R8635_RS00495 - 83877..84011 (+) 135 WP_000429437.1 hypothetical protein -
  R8635_RS00500 (PC0062_00910) - 84068..87793 (+) 3726 WP_000361192.1 phosphoribosylformylglycinamidine synthase -
  R8635_RS00505 (PC0062_00920) purF 87886..89328 (+) 1443 WP_000220627.1 amidophosphoribosyltransferase -
  R8635_RS00510 (PC0062_00930) purM 89365..90387 (+) 1023 WP_000182575.1 phosphoribosylformylglycinamidine cyclo-ligase -
  R8635_RS00515 (PC0062_00940) purN 90384..90929 (+) 546 WP_000717501.1 phosphoribosylglycinamide formyltransferase -
  R8635_RS00520 (PC0062_00950) - 91013..91522 (+) 510 WP_023396542.1 VanZ family protein -
  R8635_RS00525 (PC0062_00960) purH 91547..93094 (+) 1548 WP_000167081.1 bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase -

Sequence


Protein


Download         Length: 78 a.a.        Molecular weight: 9658.13 Da        Isoelectric Point: 6.7051

>NTDB_id=98239 R8635_RS00110 WP_000939545.1 21282..21518(+) (comW) [Streptococcus pneumoniae strain PZ900700063]
MLQKIYEQMANFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLVRYGIGCRKDFIVYHYRVAYRLYLEKLVMNRGFISC

Nucleotide


Download         Length: 237 bp        

>NTDB_id=98239 R8635_RS00110 WP_000939545.1 21282..21518(+) (comW) [Streptococcus pneumoniae strain PZ900700063]
ATGTTACAAAAAATTTATGAGCAGATGGCTAATTTCTATGATAGTATTGAAGAAGAGTATGGTCCTACATTTGGTGATAA
TTTTGACTGGGAACATGTTCATTTTAAATTTTTAATTTATTATTTAGTAAGATATGGCATTGGTTGTCGTAAGGATTTTA
TTGTTTACCATTATCGTGTTGCTTATCGTTTGTATCTTGAAAAATTGGTAATGAATCGGGGTTTTATTTCTTGTTGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comW Streptococcus pneumoniae Rx1

100

100

1

  comW Streptococcus pneumoniae D39

100

100

1

  comW Streptococcus pneumoniae R6

100

100

1

  comW Streptococcus pneumoniae TIGR4

100

100

1

  comW Streptococcus mitis SK321

75.641

100

0.756

  comW Streptococcus mitis NCTC 12261

75.325

98.718

0.744


Multiple sequence alignment