Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | UXQ32_RS09415 | Genome accession | NZ_CP151255 |
| Coordinates | 1925181..1925651 (-) | Length | 156 a.a. |
| NCBI ID | WP_000934760.1 | Uniprot ID | A0AAN2D761 |
| Organism | Staphylococcus aureus strain BSN168 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1890264..1935791 | 1925181..1925651 | within | 0 |
Gene organization within MGE regions
Location: 1890264..1935791
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| UXQ32_RS09145 (UXQ32_09145) | - | 1890264..1890779 (-) | 516 | WP_000163283.1 | type 1 glutamine amidotransferase domain-containing protein | - |
| UXQ32_RS09150 (UXQ32_09150) | - | 1890910..1891071 (-) | 162 | WP_001005407.1 | SE1561 family protein | - |
| UXQ32_RS09155 (UXQ32_09155) | - | 1891419..1891499 (+) | 81 | WP_100250272.1 | hypothetical protein | - |
| UXQ32_RS09160 (UXQ32_09160) | - | 1891825..1892010 (-) | 186 | WP_001286805.1 | hypothetical protein | - |
| UXQ32_RS09165 (UXQ32_09165) | - | 1892012..1892122 (-) | 111 | WP_000139423.1 | hypothetical protein | - |
| UXQ32_RS09170 (UXQ32_09170) | - | 1892193..1892345 (-) | 153 | WP_001788502.1 | hypothetical protein | - |
| UXQ32_RS09175 (UXQ32_09175) | - | 1892588..1894033 (-) | 1446 | WP_001148133.1 | SH3 domain-containing protein | - |
| UXQ32_RS09180 (UXQ32_09180) | - | 1894014..1894451 (-) | 438 | WP_000354132.1 | phage holin | - |
| UXQ32_RS09185 (UXQ32_09185) | - | 1894507..1894902 (-) | 396 | WP_000398874.1 | hypothetical protein | - |
| UXQ32_RS09190 (UXQ32_09190) | - | 1894908..1896080 (-) | 1173 | WP_107383229.1 | BppU family phage baseplate upper protein | - |
| UXQ32_RS09195 (UXQ32_09195) | - | 1896093..1897991 (-) | 1899 | WP_107383230.1 | glucosaminidase domain-containing protein | - |
| UXQ32_RS09200 (UXQ32_09200) | - | 1898128..1898427 (-) | 300 | WP_000466784.1 | DUF2951 domain-containing protein | - |
| UXQ32_RS09205 (UXQ32_09205) | - | 1898468..1898641 (-) | 174 | WP_001790193.1 | XkdX family protein | - |
| UXQ32_RS09210 (UXQ32_09210) | - | 1898645..1899022 (-) | 378 | WP_015984508.1 | DUF2977 domain-containing protein | - |
| UXQ32_RS09215 (UXQ32_09215) | - | 1899022..1900845 (-) | 1824 | WP_107383231.1 | phage baseplate upper protein | - |
| UXQ32_RS09220 (UXQ32_09220) | - | 1900845..1902755 (-) | 1911 | WP_176425964.1 | hypothetical protein | - |
| UXQ32_RS09225 (UXQ32_09225) | - | 1902770..1904671 (-) | 1902 | WP_176425965.1 | SGNH/GDSL hydrolase family protein | - |
| UXQ32_RS09230 (UXQ32_09230) | - | 1904680..1905627 (-) | 948 | WP_000350680.1 | phage tail family protein | - |
| UXQ32_RS09235 (UXQ32_09235) | - | 1905640..1909107 (-) | 3468 | WP_176425966.1 | hypothetical protein | - |
| UXQ32_RS09240 (UXQ32_09240) | - | 1909124..1909468 (-) | 345 | WP_000105583.1 | hypothetical protein | - |
| UXQ32_RS09245 (UXQ32_09245) | - | 1909498..1909863 (-) | 366 | WP_107383234.1 | tail assembly chaperone | - |
| UXQ32_RS09250 (UXQ32_09250) | - | 1909926..1910507 (-) | 582 | WP_000002576.1 | phage major tail protein, TP901-1 family | - |
| UXQ32_RS09255 (UXQ32_09255) | - | 1910526..1910909 (-) | 384 | WP_000188640.1 | hypothetical protein | - |
| UXQ32_RS09260 (UXQ32_09260) | - | 1910921..1911268 (-) | 348 | WP_001017815.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| UXQ32_RS09265 (UXQ32_09265) | - | 1911268..1911570 (-) | 303 | WP_107383235.1 | hypothetical protein | - |
| UXQ32_RS09270 (UXQ32_09270) | - | 1911567..1911899 (-) | 333 | WP_061653290.1 | phage head-tail connector protein | - |
| UXQ32_RS09275 (UXQ32_09275) | - | 1911908..1912195 (-) | 288 | WP_061047257.1 | hypothetical protein | - |
| UXQ32_RS09280 (UXQ32_09280) | - | 1912217..1913191 (-) | 975 | WP_000438500.1 | phage major capsid protein | - |
| UXQ32_RS09285 (UXQ32_09285) | - | 1913205..1913825 (-) | 621 | WP_033858039.1 | DUF4355 domain-containing protein | - |
| UXQ32_RS09290 (UXQ32_09290) | - | 1913934..1914104 (-) | 171 | WP_000072207.1 | hypothetical protein | - |
| UXQ32_RS09295 (UXQ32_09295) | - | 1914177..1915172 (-) | 996 | WP_001133043.1 | minor capsid protein | - |
| UXQ32_RS09300 (UXQ32_09300) | - | 1915179..1916714 (-) | 1536 | WP_176425967.1 | phage portal protein | - |
| UXQ32_RS09305 (UXQ32_09305) | - | 1916725..1918002 (-) | 1278 | WP_176425968.1 | PBSX family phage terminase large subunit | - |
| UXQ32_RS09310 (UXQ32_09310) | - | 1917989..1918429 (-) | 441 | WP_001003271.1 | terminase small subunit | - |
| UXQ32_RS09315 (UXQ32_09315) | - | 1918616..1919035 (-) | 420 | WP_000058632.1 | transcriptional regulator | - |
| UXQ32_RS09320 (UXQ32_09320) | - | 1919050..1919196 (-) | 147 | WP_000989998.1 | hypothetical protein | - |
| UXQ32_RS09325 (UXQ32_09325) | - | 1919197..1919562 (-) | 366 | WP_072467781.1 | hypothetical protein | - |
| UXQ32_RS09330 (UXQ32_09330) | rinB | 1919563..1919736 (-) | 174 | WP_001652281.1 | transcriptional activator RinB | - |
| UXQ32_RS09335 (UXQ32_09335) | - | 1919729..1919932 (-) | 204 | WP_001072795.1 | hypothetical protein | - |
| UXQ32_RS09340 (UXQ32_09340) | - | 1919929..1920123 (-) | 195 | WP_000132921.1 | hypothetical protein | - |
| UXQ32_RS09345 (UXQ32_09345) | - | 1920120..1920326 (-) | 207 | WP_000617154.1 | DUF1381 domain-containing protein | - |
| UXQ32_RS09350 (UXQ32_09350) | - | 1920363..1920899 (-) | 537 | WP_049280875.1 | dUTPase | - |
| UXQ32_RS09355 (UXQ32_09355) | - | 1920914..1921075 (-) | 162 | WP_192831500.1 | hypothetical protein | - |
| UXQ32_RS09360 (UXQ32_09360) | - | 1921076..1921357 (-) | 282 | WP_049274456.1 | hypothetical protein | - |
| UXQ32_RS09365 (UXQ32_09365) | - | 1921358..1921531 (-) | 174 | WP_000028424.1 | hypothetical protein | - |
| UXQ32_RS09370 (UXQ32_09370) | - | 1921521..1921772 (-) | 252 | WP_001065064.1 | DUF1024 family protein | - |
| UXQ32_RS09375 (UXQ32_09375) | - | 1921765..1922196 (-) | 432 | WP_049274797.1 | hypothetical protein | - |
| UXQ32_RS09380 (UXQ32_09380) | - | 1922193..1922576 (-) | 384 | WP_053007324.1 | YopX family protein | - |
| UXQ32_RS09385 (UXQ32_09385) | - | 1922573..1922974 (-) | 402 | WP_000695766.1 | hypothetical protein | - |
| UXQ32_RS09390 (UXQ32_09390) | - | 1922987..1923235 (-) | 249 | WP_001126832.1 | phi PVL orf 51-like protein | - |
| UXQ32_RS09395 (UXQ32_09395) | - | 1923236..1923607 (-) | 372 | WP_135783517.1 | SA1788 family PVL leukocidin-associated protein | - |
| UXQ32_RS09400 (UXQ32_09400) | - | 1923620..1924024 (-) | 405 | WP_000401972.1 | RusA family crossover junction endodeoxyribonuclease | - |
| UXQ32_RS09405 (UXQ32_09405) | - | 1924033..1924251 (-) | 219 | WP_000338525.1 | hypothetical protein | - |
| UXQ32_RS09410 (UXQ32_09410) | - | 1924258..1925151 (-) | 894 | WP_000148335.1 | DnaD domain-containing protein | - |
| UXQ32_RS09415 (UXQ32_09415) | ssbA | 1925181..1925651 (-) | 471 | WP_000934760.1 | single-stranded DNA-binding protein | Machinery gene |
| UXQ32_RS09420 (UXQ32_09420) | - | 1925652..1926269 (-) | 618 | WP_071621397.1 | MBL fold metallo-hydrolase | - |
| UXQ32_RS09425 (UXQ32_09425) | - | 1926350..1927270 (-) | 921 | WP_341579103.1 | recombinase RecT | - |
| UXQ32_RS09430 (UXQ32_09430) | - | 1927272..1929215 (-) | 1944 | WP_031783377.1 | AAA family ATPase | - |
| UXQ32_RS09435 (UXQ32_09435) | - | 1929224..1929487 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| UXQ32_RS09440 (UXQ32_09440) | - | 1929496..1929756 (-) | 261 | WP_000291488.1 | DUF1108 family protein | - |
| UXQ32_RS09445 (UXQ32_09445) | - | 1929849..1930010 (-) | 162 | WP_000066025.1 | DUF1270 domain-containing protein | - |
| UXQ32_RS09450 (UXQ32_09450) | - | 1930003..1930224 (-) | 222 | WP_000594792.1 | hypothetical protein | - |
| UXQ32_RS09455 (UXQ32_09455) | - | 1930296..1930898 (+) | 603 | WP_031877691.1 | hypothetical protein | - |
| UXQ32_RS09460 (UXQ32_09460) | - | 1930908..1931051 (-) | 144 | WP_031877690.1 | hypothetical protein | - |
| UXQ32_RS09465 (UXQ32_09465) | - | 1931082..1931276 (-) | 195 | WP_001148857.1 | hypothetical protein | - |
| UXQ32_RS09470 (UXQ32_09470) | - | 1931293..1932069 (-) | 777 | WP_061389040.1 | phage antirepressor | - |
| UXQ32_RS09475 (UXQ32_09475) | - | 1932085..1932303 (-) | 219 | WP_001198673.1 | helix-turn-helix transcriptional regulator | - |
| UXQ32_RS09480 (UXQ32_09480) | - | 1932445..1933164 (+) | 720 | WP_000358224.1 | XRE family transcriptional regulator | - |
| UXQ32_RS09485 (UXQ32_09485) | - | 1933234..1933401 (+) | 168 | WP_000705238.1 | hypothetical protein | - |
| UXQ32_RS09490 (UXQ32_09490) | - | 1933541..1934473 (+) | 933 | WP_000392183.1 | hypothetical protein | - |
| UXQ32_RS09495 (UXQ32_09495) | - | 1934453..1934632 (-) | 180 | WP_000337827.1 | hypothetical protein | - |
| UXQ32_RS09500 (UXQ32_09500) | - | 1934745..1935791 (+) | 1047 | WP_001145722.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17641.52 Da Isoelectric Point: 5.2672
>NTDB_id=975972 UXQ32_RS09415 WP_000934760.1 1925181..1925651(-) (ssbA) [Staphylococcus aureus strain BSN168]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=975972 UXQ32_RS09415 WP_000934760.1 1925181..1925651(-) (ssbA) [Staphylococcus aureus strain BSN168]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTGA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.768 |
100 |
0.372 |
| ssb | Neisseria meningitidis MC58 |
32.948 |
100 |
0.365 |
| ssb | Neisseria gonorrhoeae MS11 |
32.948 |
100 |
0.365 |