Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   UXR25_RS05710 Genome accession   NZ_CP151146
Coordinates   1148651..1149121 (+) Length   156 a.a.
NCBI ID   WP_000934768.1    Uniprot ID   -
Organism   Staphylococcus aureus strain BSN152     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1138042..1180452 1148651..1149121 within 0


Gene organization within MGE regions


Location: 1138042..1180452
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  UXR25_RS05630 (UXR25_05630) - 1138042..1139427 (-) 1386 WP_000861313.1 recombinase family protein -
  UXR25_RS05635 (UXR25_05635) - 1139634..1140314 (-) 681 WP_000392109.1 type II toxin-antitoxin system PemK/MazF family toxin -
  UXR25_RS05640 (UXR25_05640) - 1140350..1141069 (-) 720 WP_000358220.1 XRE family transcriptional regulator -
  UXR25_RS05645 (UXR25_05645) - 1141211..1141429 (+) 219 WP_001198673.1 helix-turn-helix transcriptional regulator -
  UXR25_RS05650 (UXR25_05650) - 1141444..1141752 (+) 309 WP_001153965.1 hypothetical protein -
  UXR25_RS05655 (UXR25_05655) - 1141909..1142697 (+) 789 WP_001148571.1 phage antirepressor KilAC domain-containing protein -
  UXR25_RS05660 (UXR25_05660) - 1142714..1142908 (+) 195 WP_000390105.1 hypothetical protein -
  UXR25_RS05665 (UXR25_05665) - 1142962..1143705 (+) 744 WP_001572437.1 phage antirepressor KilAC domain-containing protein -
  UXR25_RS05670 (UXR25_05670) - 1143881..1144111 (-) 231 WP_000395455.1 hypothetical protein -
  UXR25_RS05675 (UXR25_05675) - 1144161..1144298 (+) 138 WP_000230552.1 hypothetical protein -
  UXR25_RS05680 (UXR25_05680) - 1144291..1144452 (+) 162 WP_000066026.1 DUF1270 family protein -
  UXR25_RS05685 (UXR25_05685) - 1144546..1144806 (+) 261 WP_000291075.1 DUF1108 family protein -
  UXR25_RS05690 (UXR25_05690) - 1144815..1145078 (+) 264 WP_001205732.1 hypothetical protein -
  UXR25_RS05695 (UXR25_05695) - 1145087..1147030 (+) 1944 WP_000700555.1 AAA family ATPase -
  UXR25_RS05700 (UXR25_05700) - 1147032..1147952 (+) 921 WP_000138475.1 recombinase RecT -
  UXR25_RS05705 (UXR25_05705) - 1148033..1148650 (+) 618 WP_071890040.1 MBL fold metallo-hydrolase -
  UXR25_RS05710 (UXR25_05710) ssbA 1148651..1149121 (+) 471 WP_000934768.1 single-stranded DNA-binding protein Machinery gene
  UXR25_RS05715 (UXR25_05715) - 1149151..1150038 (+) 888 WP_000148306.1 DnaD domain protein -
  UXR25_RS05720 (UXR25_05720) - 1150045..1150263 (+) 219 WP_000338528.1 hypothetical protein -
  UXR25_RS05725 (UXR25_05725) - 1150272..1150679 (+) 408 WP_031844431.1 RusA family crossover junction endodeoxyribonuclease -
  UXR25_RS05730 (UXR25_05730) - 1150679..1150864 (+) 186 WP_031768172.1 DUF3113 family protein -
  UXR25_RS05735 (UXR25_05735) - 1150865..1151224 (+) 360 WP_031768174.1 SA1788 family PVL leukocidin-associated protein -
  UXR25_RS05740 (UXR25_05740) - 1151228..1151470 (+) 243 WP_000131382.1 SAV1978 family virulence-associated passenger protein -
  UXR25_RS05745 (UXR25_05745) - 1151511..1151762 (+) 252 WP_001065074.1 DUF1024 family protein -
  UXR25_RS05750 (UXR25_05750) - 1151752..1151934 (+) 183 WP_000028425.1 hypothetical protein -
  UXR25_RS05755 (UXR25_05755) - 1151927..1152463 (+) 537 WP_000185704.1 dUTPase -
  UXR25_RS05760 (UXR25_05760) - 1152500..1152673 (+) 174 WP_001209219.1 hypothetical protein -
  UXR25_RS05765 (UXR25_05765) - 1152690..1152896 (+) 207 WP_001621289.1 DUF1381 domain-containing protein -
  UXR25_RS05770 (UXR25_05770) rinB 1152893..1153066 (+) 174 WP_000595244.1 transcriptional activator RinB -
  UXR25_RS05775 (UXR25_05775) - 1153067..1153213 (+) 147 WP_000990001.1 hypothetical protein -
  UXR25_RS05780 (UXR25_05780) - 1153237..1153659 (+) 423 WP_000162696.1 RinA family phage transcriptional activator -
  UXR25_RS05785 (UXR25_05785) - 1153846..1154286 (+) 441 WP_001003272.1 terminase small subunit -
  UXR25_RS05790 (UXR25_05790) - 1154273..1155550 (+) 1278 WP_000169945.1 PBSX family phage terminase large subunit -
  UXR25_RS05795 (UXR25_05795) - 1155561..1157099 (+) 1539 WP_031766723.1 phage portal protein -
  UXR25_RS05800 (UXR25_05800) - 1157106..1158101 (+) 996 WP_156991916.1 minor capsid protein -
  UXR25_RS05805 (UXR25_05805) - 1158174..1158344 (+) 171 WP_000072202.1 hypothetical protein -
  UXR25_RS05810 (UXR25_05810) - 1158372..1158459 (+) 88 Protein_1133 hypothetical protein -
  UXR25_RS05815 (UXR25_05815) - 1158453..1159073 (+) 621 WP_341514797.1 DUF4355 domain-containing protein -
  UXR25_RS05820 (UXR25_05820) - 1159087..1160061 (+) 975 WP_000438512.1 phage major capsid protein -
  UXR25_RS05825 (UXR25_05825) - 1160083..1160370 (+) 288 WP_001114088.1 hypothetical protein -
  UXR25_RS05830 (UXR25_05830) - 1160379..1160711 (+) 333 WP_000208960.1 phage head-tail connector protein -
  UXR25_RS05835 (UXR25_05835) - 1160708..1161010 (+) 303 WP_001268312.1 hypothetical protein -
  UXR25_RS05840 (UXR25_05840) - 1161010..1161357 (+) 348 WP_001017815.1 HK97-gp10 family putative phage morphogenesis protein -
  UXR25_RS05845 (UXR25_05845) - 1161369..1161752 (+) 384 WP_000188645.1 hypothetical protein -
  UXR25_RS05850 (UXR25_05850) - 1161771..1162352 (+) 582 WP_015977705.1 phage major tail protein, TP901-1 family -
  UXR25_RS05855 (UXR25_05855) - 1162414..1162779 (+) 366 WP_001100161.1 tail assembly chaperone -
  UXR25_RS05860 (UXR25_05860) - 1162809..1163153 (+) 345 WP_000105584.1 hypothetical protein -
  UXR25_RS05865 (UXR25_05865) - 1163170..1166637 (+) 3468 WP_000141480.1 hypothetical protein -
  UXR25_RS05870 (UXR25_05870) - 1166650..1167597 (+) 948 WP_000350675.1 phage tail family protein -
  UXR25_RS05875 (UXR25_05875) - 1167606..1169507 (+) 1902 WP_031864422.1 SGNH/GDSL hydrolase family protein -
  UXR25_RS05880 (UXR25_05880) - 1169522..1171432 (+) 1911 WP_000066423.1 hypothetical protein -
  UXR25_RS05885 (UXR25_05885) - 1171432..1173255 (+) 1824 WP_341514801.1 phage baseplate upper protein -
  UXR25_RS05890 (UXR25_05890) - 1173255..1173632 (+) 378 WP_000705902.1 DUF2977 domain-containing protein -
  UXR25_RS05895 (UXR25_05895) - 1173636..1173809 (+) 174 WP_001800921.1 XkdX family protein -
  UXR25_RS05900 (UXR25_05900) - 1173849..1174148 (+) 300 WP_000466778.1 DUF2951 domain-containing protein -
  UXR25_RS05905 (UXR25_05905) - 1174285..1176183 (+) 1899 WP_000524015.1 glucosaminidase domain-containing protein -
  UXR25_RS05910 (UXR25_05910) - 1176196..1177368 (+) 1173 WP_341514802.1 BppU family phage baseplate upper protein -
  UXR25_RS05915 (UXR25_05915) - 1177374..1177769 (+) 396 WP_000398882.1 hypothetical protein -
  UXR25_RS05920 (UXR25_05920) - 1177826..1178263 (+) 438 WP_000354135.1 phage holin -
  UXR25_RS05925 (UXR25_05925) - 1178244..1179689 (+) 1446 WP_001148142.1 SH3 domain-containing protein -
  UXR25_RS05930 (UXR25_05930) - 1179932..1180084 (+) 153 WP_001788502.1 hypothetical protein -
  UXR25_RS05935 (UXR25_05935) - 1180155..1180265 (+) 111 WP_000139423.1 hypothetical protein -
  UXR25_RS05940 (UXR25_05940) - 1180267..1180452 (+) 186 WP_001286805.1 hypothetical protein -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17747.64 Da        Isoelectric Point: 4.9816

>NTDB_id=975389 UXR25_RS05710 WP_000934768.1 1148651..1149121(+) (ssbA) [Staphylococcus aureus strain BSN152]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYKQQAQQSRGQSQYPYNKPVKDNPFANANDPIEIDDDDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=975389 UXR25_RS05710 WP_000934768.1 1148651..1149121(+) (ssbA) [Staphylococcus aureus strain BSN152]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACAAACAACAAGCGCAACAATCACGTGGACAGTCTCAATATCCATATAACAAAC
CAGTAAAAGATAATCCGTTCGCAAATGCGAATGATCCTATTGAAATAGATGACGATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.367

100

0.628

  ssb Latilactobacillus sakei subsp. sakei 23K

51.765

100

0.564

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Neisseria meningitidis MC58

33.526

100

0.372

  ssb Neisseria gonorrhoeae MS11

33.526

100

0.372

  ssb Glaesserella parasuis strain SC1401

32.203

100

0.365


Multiple sequence alignment