Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | WOC56_RS00055 | Genome accession | NZ_CP150779 |
| Coordinates | 3501..3971 (-) | Length | 156 a.a. |
| NCBI ID | WP_000934760.1 | Uniprot ID | A0AAN2D761 |
| Organism | Staphylococcus aureus strain TUM20823 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 36..29558 | 3501..3971 | within | 0 |
Gene organization within MGE regions
Location: 36..29558
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| WOC56_RS00010 (WOC56_00010) | - | 36..242 (-) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| WOC56_RS00015 (WOC56_00015) | - | 239..484 (-) | 246 | WP_001282074.1 | hypothetical protein | - |
| WOC56_RS00020 (WOC56_00020) | - | 521..1057 (-) | 537 | WP_001066447.1 | dUTP diphosphatase | - |
| WOC56_RS00025 (WOC56_00025) | - | 1050..1298 (-) | 249 | WP_001065094.1 | DUF1024 family protein | - |
| WOC56_RS00030 (WOC56_00030) | - | 1313..1555 (-) | 243 | WP_000131370.1 | SAV1978 family virulence-associated passenger protein | - |
| WOC56_RS00035 (WOC56_00035) | - | 1559..1927 (-) | 369 | WP_000101288.1 | SA1788 family PVL leukocidin-associated protein | - |
| WOC56_RS00040 (WOC56_00040) | - | 1940..2344 (-) | 405 | WP_000401960.1 | RusA family crossover junction endodeoxyribonuclease | - |
| WOC56_RS00045 (WOC56_00045) | - | 2353..2571 (-) | 219 | WP_000338530.1 | hypothetical protein | - |
| WOC56_RS00050 (WOC56_00050) | - | 2578..3471 (-) | 894 | WP_000148321.1 | DnaD domain-containing protein | - |
| WOC56_RS00055 (WOC56_00055) | ssbA | 3501..3971 (-) | 471 | WP_000934760.1 | single-stranded DNA-binding protein | Machinery gene |
| WOC56_RS00060 (WOC56_00060) | - | 3972..4589 (-) | 618 | WP_071665632.1 | MBL fold metallo-hydrolase | - |
| WOC56_RS00065 (WOC56_00065) | - | 4670..5590 (-) | 921 | WP_000138475.1 | recombinase RecT | - |
| WOC56_RS00070 (WOC56_00070) | - | 5592..7535 (-) | 1944 | WP_000700555.1 | AAA family ATPase | - |
| WOC56_RS00075 (WOC56_00075) | - | 7544..7807 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| WOC56_RS00080 (WOC56_00080) | - | 7816..8076 (-) | 261 | WP_000291510.1 | DUF1108 family protein | - |
| WOC56_RS00085 (WOC56_00085) | - | 8081..8383 (-) | 303 | WP_000165371.1 | DUF2482 family protein | - |
| WOC56_RS00090 (WOC56_00090) | - | 8478..8639 (-) | 162 | WP_000048129.1 | DUF1270 family protein | - |
| WOC56_RS00095 (WOC56_00095) | - | 8636..8959 (-) | 324 | WP_001120201.1 | DUF771 domain-containing protein | - |
| WOC56_RS00100 (WOC56_00100) | - | 9014..9394 (+) | 381 | WP_000762521.1 | DUF2513 domain-containing protein | - |
| WOC56_RS00105 (WOC56_00105) | - | 9381..9578 (-) | 198 | WP_001148862.1 | hypothetical protein | - |
| WOC56_RS00110 (WOC56_00110) | - | 9594..10346 (-) | 753 | WP_001148605.1 | phage antirepressor KilAC domain-containing protein | - |
| WOC56_RS00115 (WOC56_00115) | - | 10397..10726 (+) | 330 | WP_000128907.1 | hypothetical protein | - |
| WOC56_RS00120 (WOC56_00120) | - | 10715..10930 (-) | 216 | WP_001025404.1 | MW1434 family type I TA system toxin | - |
| WOC56_RS00125 (WOC56_00125) | - | 10946..11209 (-) | 264 | WP_000854072.1 | helix-turn-helix transcriptional regulator | - |
| WOC56_RS00130 (WOC56_00130) | - | 11206..11379 (-) | 174 | WP_001801500.1 | hypothetical protein | - |
| WOC56_RS00135 (WOC56_00135) | - | 11342..12055 (+) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| WOC56_RS00140 (WOC56_00140) | - | 12071..13003 (+) | 933 | WP_000759682.1 | exonuclease domain-containing protein | - |
| WOC56_RS00145 (WOC56_00145) | - | 13009..13350 (+) | 342 | WP_000591749.1 | hypothetical protein | - |
| WOC56_RS00150 (WOC56_00150) | - | 13554..13736 (+) | 183 | WP_000705248.1 | hypothetical protein | - |
| WOC56_RS00155 (WOC56_00155) | - | 13836..14300 (+) | 465 | WP_000825947.1 | hypothetical protein | - |
| WOC56_RS00160 (WOC56_00160) | - | 14359..15396 (+) | 1038 | WP_000857191.1 | site-specific integrase | - |
| WOC56_RS00165 (WOC56_00165) | sph | 15453..16277 (+) | 825 | Protein_32 | sphingomyelin phosphodiesterase | - |
| WOC56_RS00170 (WOC56_00170) | lukG | 16515..17531 (-) | 1017 | WP_000595324.1 | bi-component leukocidin LukGH subunit G | - |
| WOC56_RS00175 (WOC56_00175) | lukH | 17553..18608 (-) | 1056 | WP_000791407.1 | bi-component leukocidin LukGH subunit H | - |
| WOC56_RS00180 (WOC56_00180) | - | 19043..20266 (+) | 1224 | WP_000206638.1 | ArgE/DapE family deacylase | - |
| WOC56_RS00185 (WOC56_00185) | - | 20638..21483 (-) | 846 | WP_000812008.1 | class I SAM-dependent methyltransferase | - |
| WOC56_RS00190 (WOC56_00190) | - | 21545..22456 (-) | 912 | WP_000825510.1 | iron-hydroxamate ABC transporter substrate-binding protein | - |
| WOC56_RS00195 (WOC56_00195) | - | 22617..23924 (+) | 1308 | WP_001045079.1 | TrkH family potassium uptake protein | - |
| WOC56_RS00200 (WOC56_00200) | - | 24777..25220 (-) | 444 | WP_000022887.1 | GNAT family N-acetyltransferase | - |
| WOC56_RS00205 (WOC56_00205) | - | 25326..25763 (-) | 438 | WP_011447041.1 | hypothetical protein | - |
| WOC56_RS00210 (WOC56_00210) | - | 26081..26671 (-) | 591 | WP_001293058.1 | terminase small subunit | - |
| WOC56_RS00215 (WOC56_00215) | - | 26668..26880 (-) | 213 | WP_000128898.1 | LuxR C-terminal-related transcriptional regulator | - |
| WOC56_RS00220 (WOC56_00220) | - | 26941..27487 (+) | 547 | Protein_43 | site-specific integrase | - |
| WOC56_RS00225 (WOC56_00225) | groL | 27582..29198 (-) | 1617 | WP_000240645.1 | chaperonin GroEL | - |
| WOC56_RS00230 (WOC56_00230) | groES | 29274..29558 (-) | 285 | WP_212556265.1 | co-chaperone GroES | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17641.52 Da Isoelectric Point: 5.2672
>NTDB_id=972466 WOC56_RS00055 WP_000934760.1 3501..3971(-) (ssbA) [Staphylococcus aureus strain TUM20823]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=972466 WOC56_RS00055 WP_000934760.1 3501..3971(-) (ssbA) [Staphylococcus aureus strain TUM20823]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.768 |
100 |
0.372 |
| ssb | Neisseria meningitidis MC58 |
32.948 |
100 |
0.365 |
| ssb | Neisseria gonorrhoeae MS11 |
32.948 |
100 |
0.365 |