Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | WOC50_RS00605 | Genome accession | NZ_CP150766 |
| Coordinates | 109162..109632 (+) | Length | 156 a.a. |
| NCBI ID | WP_000934760.1 | Uniprot ID | A0AAN2D761 |
| Organism | Staphylococcus aureus strain TUM20929 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 91650..139380 | 109162..109632 | within | 0 |
Gene organization within MGE regions
Location: 91650..139380
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| WOC50_RS00475 (WOC50_00475) | - | 91650..92495 (+) | 846 | WP_000812008.1 | class I SAM-dependent methyltransferase | - |
| WOC50_RS00480 (WOC50_00480) | - | 92867..94090 (-) | 1224 | WP_000206638.1 | ArgE/DapE family deacylase | - |
| WOC50_RS00485 (WOC50_00485) | lukH | 94525..95580 (+) | 1056 | WP_000791407.1 | bi-component leukocidin LukGH subunit H | - |
| WOC50_RS00490 (WOC50_00490) | lukG | 95602..96618 (+) | 1017 | WP_000595324.1 | bi-component leukocidin LukGH subunit G | - |
| WOC50_RS00495 (WOC50_00495) | sph | 96856..97680 (-) | 825 | Protein_93 | sphingomyelin phosphodiesterase | - |
| WOC50_RS00500 (WOC50_00500) | - | 97737..98774 (-) | 1038 | WP_000857191.1 | site-specific integrase | - |
| WOC50_RS00505 (WOC50_00505) | - | 98833..99297 (-) | 465 | WP_000825947.1 | hypothetical protein | - |
| WOC50_RS00510 (WOC50_00510) | - | 99397..99579 (-) | 183 | WP_000705248.1 | hypothetical protein | - |
| WOC50_RS00515 (WOC50_00515) | - | 99783..100124 (-) | 342 | WP_000591750.1 | hypothetical protein | - |
| WOC50_RS00520 (WOC50_00520) | - | 100130..101062 (-) | 933 | WP_000759682.1 | exonuclease domain-containing protein | - |
| WOC50_RS00525 (WOC50_00525) | - | 101078..101791 (-) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| WOC50_RS00530 (WOC50_00530) | - | 101754..101927 (+) | 174 | WP_001801500.1 | hypothetical protein | - |
| WOC50_RS00535 (WOC50_00535) | - | 101924..102187 (+) | 264 | WP_000854072.1 | helix-turn-helix transcriptional regulator | - |
| WOC50_RS00540 (WOC50_00540) | - | 102203..102418 (+) | 216 | WP_001025404.1 | MW1434 family type I TA system toxin | - |
| WOC50_RS00545 (WOC50_00545) | - | 102407..102736 (-) | 330 | WP_000128907.1 | hypothetical protein | - |
| WOC50_RS00550 (WOC50_00550) | - | 102787..103539 (+) | 753 | WP_001148605.1 | phage antirepressor KilAC domain-containing protein | - |
| WOC50_RS00555 (WOC50_00555) | - | 103555..103752 (+) | 198 | WP_001148862.1 | hypothetical protein | - |
| WOC50_RS00560 (WOC50_00560) | - | 103739..104119 (-) | 381 | WP_000762521.1 | DUF2513 domain-containing protein | - |
| WOC50_RS00565 (WOC50_00565) | - | 104174..104497 (+) | 324 | WP_001120201.1 | DUF771 domain-containing protein | - |
| WOC50_RS00570 (WOC50_00570) | - | 104494..104655 (+) | 162 | WP_000048129.1 | DUF1270 family protein | - |
| WOC50_RS00575 (WOC50_00575) | - | 104750..105052 (+) | 303 | WP_000165371.1 | DUF2482 family protein | - |
| WOC50_RS00580 (WOC50_00580) | - | 105057..105317 (+) | 261 | WP_000291510.1 | DUF1108 family protein | - |
| WOC50_RS00585 (WOC50_00585) | - | 105326..105589 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| WOC50_RS00590 (WOC50_00590) | - | 105598..107541 (+) | 1944 | WP_000700555.1 | AAA family ATPase | - |
| WOC50_RS00595 (WOC50_00595) | - | 107543..108463 (+) | 921 | WP_000138475.1 | recombinase RecT | - |
| WOC50_RS00600 (WOC50_00600) | - | 108544..109161 (+) | 618 | WP_071665632.1 | MBL fold metallo-hydrolase | - |
| WOC50_RS00605 (WOC50_00605) | ssbA | 109162..109632 (+) | 471 | WP_000934760.1 | single-stranded DNA-binding protein | Machinery gene |
| WOC50_RS00610 (WOC50_00610) | - | 109662..110555 (+) | 894 | WP_000148321.1 | DnaD domain-containing protein | - |
| WOC50_RS00615 (WOC50_00615) | - | 110562..110780 (+) | 219 | WP_000338530.1 | hypothetical protein | - |
| WOC50_RS00620 (WOC50_00620) | - | 110789..111193 (+) | 405 | WP_000401960.1 | RusA family crossover junction endodeoxyribonuclease | - |
| WOC50_RS00625 (WOC50_00625) | - | 111206..111574 (+) | 369 | WP_000101288.1 | SA1788 family PVL leukocidin-associated protein | - |
| WOC50_RS00630 (WOC50_00630) | - | 111578..111820 (+) | 243 | WP_000131370.1 | SAV1978 family virulence-associated passenger protein | - |
| WOC50_RS00635 (WOC50_00635) | - | 111835..112083 (+) | 249 | WP_001065094.1 | DUF1024 family protein | - |
| WOC50_RS00640 (WOC50_00640) | - | 112076..112612 (+) | 537 | WP_001066447.1 | dUTP diphosphatase | - |
| WOC50_RS00645 (WOC50_00645) | - | 112649..112894 (+) | 246 | WP_001282074.1 | hypothetical protein | - |
| WOC50_RS00650 (WOC50_00650) | - | 112891..113097 (+) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| WOC50_RS00655 (WOC50_00655) | - | 113094..113480 (+) | 387 | WP_000592207.1 | hypothetical protein | - |
| WOC50_RS00660 (WOC50_00660) | rinB | 113477..113626 (+) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| WOC50_RS00665 (WOC50_00665) | - | 113626..113826 (+) | 201 | WP_000265043.1 | DUF1514 family protein | - |
| WOC50_RS00670 (WOC50_00670) | - | 113854..114270 (+) | 417 | WP_000590122.1 | hypothetical protein | - |
| WOC50_RS00675 (WOC50_00675) | - | 114502..114801 (+) | 300 | WP_000988336.1 | HNH endonuclease | - |
| WOC50_RS00680 (WOC50_00680) | - | 114931..115275 (+) | 345 | WP_000402904.1 | hypothetical protein | - |
| WOC50_RS00685 (WOC50_00685) | - | 115272..116934 (+) | 1663 | Protein_131 | terminase large subunit domain-containing protein | - |
| WOC50_RS00690 (WOC50_00690) | - | 116950..118137 (+) | 1188 | WP_000025274.1 | phage portal protein | - |
| WOC50_RS00695 (WOC50_00695) | - | 118121..118858 (+) | 738 | WP_000642727.1 | head maturation protease, ClpP-related | - |
| WOC50_RS00700 (WOC50_00700) | - | 118882..120027 (+) | 1146 | WP_000154559.1 | phage major capsid protein | - |
| WOC50_RS00705 (WOC50_00705) | - | 120047..120331 (+) | 285 | WP_000238236.1 | hypothetical protein | - |
| WOC50_RS00710 (WOC50_00710) | - | 120321..120605 (+) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| WOC50_RS00715 (WOC50_00715) | - | 120589..120951 (+) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| WOC50_RS00720 (WOC50_00720) | - | 120948..121352 (+) | 405 | WP_000114226.1 | HK97 gp10 family phage protein | - |
| WOC50_RS00725 (WOC50_00725) | - | 121349..121756 (+) | 408 | WP_000565498.1 | hypothetical protein | - |
| WOC50_RS00730 (WOC50_00730) | - | 121757..122401 (+) | 645 | WP_000268735.1 | major tail protein | - |
| WOC50_RS00735 (WOC50_00735) | - | 122455..122667 (+) | 213 | WP_078101489.1 | Ig-like domain-containing protein | - |
| WOC50_RS00740 (WOC50_00740) | gpG | 122717..123067 (+) | 351 | WP_001096355.1 | phage tail assembly chaperone G | - |
| WOC50_RS00745 (WOC50_00745) | gpGT | 123118..123255 (+) | 138 | WP_368409776.1 | phage tail assembly chaperone GT | - |
| WOC50_RS00750 (WOC50_00750) | - | 123312..127856 (+) | 4545 | WP_000504557.1 | phage tail tape measure protein | - |
| WOC50_RS00755 (WOC50_00755) | - | 127853..129337 (+) | 1485 | WP_000567393.1 | phage distal tail protein | - |
| WOC50_RS00760 (WOC50_00760) | - | 129353..133138 (+) | 3786 | WP_000582184.1 | phage tail spike protein | - |
| WOC50_RS00765 (WOC50_00765) | - | 133128..133280 (+) | 153 | WP_000654329.1 | hypothetical protein | - |
| WOC50_RS00770 (WOC50_00770) | - | 133327..133614 (+) | 288 | WP_001040255.1 | hypothetical protein | - |
| WOC50_RS00775 (WOC50_00775) | - | 133670..134044 (+) | 375 | WP_000340977.1 | hypothetical protein | - |
| WOC50_RS00780 (WOC50_00780) | sep | 134456..135238 (+) | 783 | WP_000034846.1 | staphylococcal enterotoxin type P | - |
| WOC50_RS00785 (WOC50_00785) | pepG1 | 135483..135617 (+) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| WOC50_RS00790 (WOC50_00790) | - | 135670..135777 (-) | 108 | WP_031762631.1 | hypothetical protein | - |
| WOC50_RS00795 (WOC50_00795) | - | 135829..136083 (+) | 255 | WP_000611512.1 | phage holin | - |
| WOC50_RS00800 (WOC50_00800) | - | 136095..136850 (+) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| WOC50_RS00805 (WOC50_00805) | sak | 137041..137532 (+) | 492 | WP_000920038.1 | staphylokinase | - |
| WOC50_RS00810 (WOC50_00810) | - | 138181..138519 (+) | 339 | Protein_156 | SH3 domain-containing protein | - |
| WOC50_RS00815 (WOC50_00815) | scn | 139030..139380 (+) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17641.52 Da Isoelectric Point: 5.2672
>NTDB_id=972163 WOC50_RS00605 WP_000934760.1 109162..109632(+) (ssbA) [Staphylococcus aureus strain TUM20929]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=972163 WOC50_RS00605 WP_000934760.1 109162..109632(+) (ssbA) [Staphylococcus aureus strain TUM20929]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.768 |
100 |
0.372 |
| ssb | Neisseria meningitidis MC58 |
32.948 |
100 |
0.365 |
| ssb | Neisseria gonorrhoeae MS11 |
32.948 |
100 |
0.365 |