Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   NST93_RS14130 Genome accession   NZ_CP150301
Coordinates   2779214..2779714 (-) Length   166 a.a.
NCBI ID   WP_405098109.1    Uniprot ID   -
Organism   Oceanobacillus sp. FSL H7-0719     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2767720..2845873 2779214..2779714 within 0


Gene organization within MGE regions


Location: 2767720..2845873
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NST93_RS14075 (NST93_14015) - 2767720..2768091 (-) 372 WP_405098087.1 hypothetical protein -
  NST93_RS14080 (NST93_14020) dnaB 2768930..2770306 (-) 1377 WP_405098089.1 replicative DNA helicase -
  NST93_RS14085 (NST93_14025) rplI 2770506..2770955 (-) 450 WP_405098091.1 50S ribosomal protein L9 -
  NST93_RS14090 (NST93_14030) - 2770952..2772928 (-) 1977 WP_405098093.1 DHH family phosphoesterase -
  NST93_RS14095 (NST93_14035) - 2772969..2773916 (-) 948 WP_405098095.1 YybS family protein -
  NST93_RS14100 (NST93_14040) - 2774241..2774735 (+) 495 WP_405098097.1 hypothetical protein -
  NST93_RS14105 (NST93_14045) nrdF 2774790..2775758 (-) 969 WP_405098099.1 class 1b ribonucleoside-diphosphate reductase subunit beta -
  NST93_RS14110 (NST93_14050) nrdE 2775746..2777839 (-) 2094 WP_405098101.1 class 1b ribonucleoside-diphosphate reductase subunit alpha -
  NST93_RS14115 (NST93_14055) nrdI 2777836..2778195 (-) 360 WP_405098103.1 class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI -
  NST93_RS14120 (NST93_14060) - 2778192..2778416 (-) 225 WP_405098105.1 glutaredoxin family protein -
  NST93_RS14125 (NST93_14065) rpsR 2778864..2779100 (-) 237 WP_405098107.1 30S ribosomal protein S18 -
  NST93_RS14130 (NST93_14070) ssbA 2779214..2779714 (-) 501 WP_405098109.1 single-stranded DNA-binding protein Machinery gene
  NST93_RS14135 (NST93_14075) rpsF 2779730..2780017 (-) 288 WP_405098111.1 30S ribosomal protein S6 -
  NST93_RS14140 (NST93_14080) ychF 2780218..2781318 (-) 1101 WP_405098113.1 redox-regulated ATPase YchF -
  NST93_RS14145 (NST93_14085) - 2781769..2781972 (-) 204 WP_405098115.1 DUF951 domain-containing protein -
  NST93_RS14150 (NST93_14090) - 2782115..2783122 (-) 1008 WP_405098117.1 hypothetical protein -
  NST93_RS14155 (NST93_14095) yyaC 2783202..2783816 (+) 615 WP_405098119.1 spore protease YyaC -
  NST93_RS14160 (NST93_14100) - 2783870..2784574 (-) 705 WP_405103898.1 DUF554 domain-containing protein -
  NST93_RS14165 (NST93_14105) - 2784688..2785524 (-) 837 WP_405098121.1 ParB/RepB/Spo0J family partition protein -
  NST93_RS14170 (NST93_14110) - 2785505..2786278 (-) 774 WP_405098123.1 ParA family protein -
  NST93_RS14175 (NST93_14115) noc 2786498..2787361 (-) 864 WP_405098125.1 nucleoid occlusion protein -
  NST93_RS14180 (NST93_14120) rsmG 2787602..2788318 (-) 717 WP_405098127.1 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG -
  NST93_RS14185 (NST93_14125) mnmG 2788374..2790257 (-) 1884 WP_405103900.1 tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG -
  NST93_RS14190 (NST93_14130) mnmE 2790299..2791675 (-) 1377 WP_405098129.1 tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE -
  NST93_RS14195 (NST93_14135) jag 2792305..2792919 (-) 615 WP_405098131.1 RNA-binding cell elongation regulator Jag/EloR -
  NST93_RS14200 (NST93_14140) yidC 2792916..2793668 (-) 753 WP_405103902.1 membrane protein insertase YidC -
  NST93_RS14205 (NST93_14145) rnpA 2793780..2794124 (-) 345 WP_405098133.1 ribonuclease P protein component -
  NST93_RS14210 (NST93_14150) rpmH 2794245..2794379 (-) 135 WP_205138238.1 50S ribosomal protein L34 -
  NST93_RS14215 (NST93_14155) dnaA 2795342..2796685 (+) 1344 WP_405098136.1 chromosomal replication initiator protein DnaA -
  NST93_RS14220 (NST93_14160) dnaN 2796896..2798032 (+) 1137 WP_405098138.1 DNA polymerase III subunit beta -
  NST93_RS14225 (NST93_14165) yaaA 2798351..2798569 (+) 219 WP_405098140.1 S4 domain-containing protein YaaA -
  NST93_RS14230 (NST93_14170) recF 2798575..2799696 (+) 1122 WP_405098142.1 DNA replication/repair protein RecF -
  NST93_RS14235 (NST93_14175) remB 2799719..2799991 (+) 273 WP_405098144.1 extracellular matrix regulator RemB -
  NST93_RS14240 (NST93_14180) gyrB 2800073..2801998 (+) 1926 WP_405098146.1 DNA topoisomerase (ATP-hydrolyzing) subunit B -
  NST93_RS14245 (NST93_14185) gyrA 2802117..2804618 (+) 2502 WP_405098148.1 DNA gyrase subunit A -
  NST93_RS14250 (NST93_14190) - 2804691..2805788 (+) 1098 WP_405103904.1 HD-GYP domain-containing protein -
  NST93_RS14255 (NST93_14195) - 2805840..2807054 (+) 1215 WP_405098150.1 carboxylate--amine ligase -
  NST93_RS14260 (NST93_14200) guaB 2807207..2808682 (+) 1476 WP_405098152.1 IMP dehydrogenase -
  NST93_RS14265 (NST93_14205) - 2808980..2810320 (+) 1341 WP_405098154.1 D-alanyl-D-alanine carboxypeptidase family protein -
  NST93_RS14270 (NST93_14210) serS 2810714..2811982 (+) 1269 WP_405098156.1 serine--tRNA ligase -
  NST93_RS14275 (NST93_14215) - 2812248..2813972 (+) 1725 WP_405098158.1 ABC transporter ATP-binding protein -
  NST93_RS14280 (NST93_14220) - 2813969..2815825 (+) 1857 WP_405098160.1 ABC transporter ATP-binding protein -
  NST93_RS14290 (NST93_14230) proC 2816630..2817451 (+) 822 WP_405098162.1 pyrroline-5-carboxylate reductase -
  NST93_RS14300 (NST93_14240) - 2817783..2818592 (+) 810 WP_405098164.1 MBL fold metallo-hydrolase -
  NST93_RS14305 (NST93_14245) acsA 2818727..2820442 (+) 1716 WP_405098166.1 acetate--CoA ligase -
  NST93_RS14310 (NST93_14250) - 2820522..2821049 (+) 528 WP_405098168.1 hypothetical protein -
  NST93_RS14315 (NST93_14255) - 2821121..2821636 (+) 516 WP_405098170.1 type 1 glutamine amidotransferase domain-containing protein -
  NST93_RS14320 (NST93_14260) - 2821692..2822228 (-) 537 WP_405098172.1 isochorismatase family cysteine hydrolase -
  NST93_RS14325 (NST93_14265) tadA 2822328..2822801 (+) 474 WP_405098174.1 tRNA adenosine(34) deaminase TadA -
  NST93_RS14335 (NST93_14275) dnaX 2823440..2825134 (+) 1695 WP_405098176.1 DNA polymerase III subunit gamma/tau -
  NST93_RS14340 (NST93_14280) - 2825183..2825497 (+) 315 WP_405098178.1 YbaB/EbfC family nucleoid-associated protein -
  NST93_RS14345 (NST93_14285) recR 2825781..2826377 (+) 597 WP_405098180.1 recombination mediator RecR -
  NST93_RS14350 (NST93_14290) - 2826443..2826655 (+) 213 WP_405098182.1 YaaL family protein -
  NST93_RS14355 (NST93_14295) - 2826752..2827024 (+) 273 WP_405098184.1 pro-sigmaK processing inhibitor BofA family protein -
  NST93_RS14360 (NST93_14300) - 2827213..2827401 (+) 189 WP_405098186.1 sigma factor G inhibitor Gin -
  NST93_RS14365 (NST93_14305) - 2827693..2829108 (+) 1416 WP_405098188.1 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme -
  NST93_RS14370 (NST93_14310) tmk 2829122..2829775 (+) 654 WP_405098190.1 dTMP kinase -
  NST93_RS14375 (NST93_14315) - 2829772..2830101 (+) 330 WP_405098192.1 cyclic-di-AMP receptor -
  NST93_RS14380 (NST93_14320) - 2830161..2830595 (+) 435 WP_405098194.1 YaaR family protein -
  NST93_RS14385 (NST93_14325) holB 2830616..2831605 (+) 990 WP_405098196.1 DNA polymerase III subunit delta' -
  NST93_RS14390 (NST93_14330) - 2831613..2832437 (+) 825 WP_405098198.1 stage 0 sporulation family protein -
  NST93_RS14395 (NST93_14335) yabA 2832452..2832805 (+) 354 WP_405098200.1 DNA replication initiation control protein YabA -
  NST93_RS14400 (NST93_14340) - 2832965..2833708 (+) 744 WP_405098202.1 tRNA1(Val) (adenine(37)-N6)-methyltransferase -
  NST93_RS14405 (NST93_14345) - 2833725..2833967 (+) 243 WP_405098204.1 GIY-YIG nuclease family protein -
  NST93_RS14410 (NST93_14350) rsmI 2833964..2834845 (+) 882 WP_405098206.1 16S rRNA (cytidine(1402)-2'-O)-methyltransferase -
  NST93_RS14415 (NST93_14355) - 2834956..2835231 (-) 276 WP_405098208.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
  NST93_RS14420 (NST93_14360) metG 2835965..2837971 (+) 2007 WP_405098210.1 methionine--tRNA ligase -
  NST93_RS14425 (NST93_14365) - 2838062..2838838 (+) 777 WP_405098212.1 TatD family hydrolase -
  NST93_RS14430 (NST93_14370) - 2838892..2839494 (+) 603 WP_405098214.1 short chain dehydrogenase -
  NST93_RS14435 (NST93_14375) - 2839601..2839993 (-) 393 WP_405098216.1 hypothetical protein -
  NST93_RS14440 (NST93_14380) - 2840491..2841705 (+) 1215 WP_405098218.1 ubiquitin-like domain-containing protein -
  NST93_RS14445 (NST93_14385) rnmV 2841787..2842344 (+) 558 WP_405098220.1 ribonuclease M5 -
  NST93_RS14450 (NST93_14390) rsmA 2842347..2843234 (+) 888 WP_405098222.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
  NST93_RS14455 (NST93_14395) - 2843564..2843977 (+) 414 WP_405098224.1 NUDIX hydrolase -
  NST93_RS14460 (NST93_14400) - 2844012..2844407 (+) 396 WP_405098226.1 HIT family protein -
  NST93_RS14465 (NST93_14405) - 2844412..2844876 (+) 465 WP_405098228.1 GNAT family N-acetyltransferase -
  NST93_RS14470 (NST93_14410) - 2844986..2845873 (+) 888 WP_405098231.1 GNAT family N-acetyltransferase -

Sequence


Protein


Download         Length: 166 a.a.        Molecular weight: 18623.23 Da        Isoelectric Point: 4.5673

>NTDB_id=970006 NST93_RS14130 WP_405098109.1 2779214..2779714(-) (ssbA) [Oceanobacillus sp. FSL H7-0719]
MLNRVVLVGRLTRDPDLRYTPNGVAVANFNIAVNRPFSNQQGEREADFINGVVWRRQAENLANYMKKGNLIGVDGRIQTR
NYEGQDGKTVYVTEVVADSIQFLETKGASGGQGAGPSGYQQNQNQNQYQNQNQFQPNQNQNQNQSNDDPFRNNGEPIDIS
DDDLPF

Nucleotide


Download         Length: 501 bp        

>NTDB_id=970006 NST93_RS14130 WP_405098109.1 2779214..2779714(-) (ssbA) [Oceanobacillus sp. FSL H7-0719]
ATGTTAAATCGTGTCGTATTAGTTGGCAGGTTAACGAGGGATCCTGATTTACGTTATACACCGAATGGAGTAGCGGTAGC
TAACTTCAATATCGCAGTTAATCGTCCTTTTTCAAATCAGCAAGGTGAACGTGAGGCTGATTTTATCAATGGTGTCGTAT
GGCGCCGTCAAGCTGAAAACCTGGCTAATTATATGAAAAAAGGTAATTTAATTGGTGTTGATGGTCGTATACAAACACGT
AATTATGAAGGTCAGGATGGCAAGACCGTTTATGTAACAGAAGTTGTTGCTGACAGTATTCAATTCCTGGAAACAAAAGG
TGCTTCAGGTGGACAAGGAGCAGGACCATCAGGATACCAGCAAAATCAAAATCAGAACCAGTATCAAAACCAAAATCAAT
TCCAGCCAAATCAGAATCAGAACCAGAACCAATCAAATGATGATCCATTTAGAAATAATGGAGAGCCAATTGATATTTCA
GATGATGATTTGCCGTTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

63.636

100

0.675

  ssb Latilactobacillus sakei subsp. sakei 23K

58.382

100

0.608

  ssb Glaesserella parasuis strain SC1401

35.754

100

0.386

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

63.855

0.38

  ssb Neisseria meningitidis MC58

34.884

100

0.361

  ssb Neisseria gonorrhoeae MS11

34.884

100

0.361


Multiple sequence alignment