Detailed information
Overview
| Name | comC/comC2 | Type | Regulator |
| Locus tag | QML92_RS10410 | Genome accession | NZ_AP025937 |
| Coordinates | 2043558..2043683 (-) | Length | 41 a.a. |
| NCBI ID | WP_000799686.1 | Uniprot ID | P60242 |
| Organism | Streptococcus pneumoniae strain PZ900700792 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2038558..2048683
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QML92_RS10380 | - | 2038939..2040550 (-) | 1612 | Protein_2017 | YhgE/Pip domain-containing protein | - |
| QML92_RS10385 (PC0780_20190) | - | 2040678..2041220 (+) | 543 | WP_001158263.1 | TetR/AcrR family transcriptional regulator | - |
| QML92_RS10400 (PC0780_20200) | comE | 2041463..2042215 (-) | 753 | WP_000866065.1 | competence system response regulator transcription factor ComE | Regulator |
| QML92_RS10405 (PC0780_20210) | comD/comD2 | 2042212..2043537 (-) | 1326 | WP_001842237.1 | competence system sensor histidine kinase ComD | Regulator |
| QML92_RS10410 | comC/comC2 | 2043558..2043683 (-) | 126 | WP_000799686.1 | competence-stimulating peptide ComC | Regulator |
| QML92_RS10420 (PC0780_20220) | rlmH | 2043965..2044444 (-) | 480 | WP_000695929.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| QML92_RS10425 (PC0780_20230) | htrA | 2044627..2045808 (+) | 1182 | WP_000681598.1 | S1C family serine protease | Regulator |
| QML92_RS10430 (PC0780_20240) | spo0J | 2045866..2046624 (+) | 759 | WP_000410380.1 | ParB/RepB/Spo0J family partition protein | Regulator |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4907.00 Da Isoelectric Point: 11.0006
>NTDB_id=95325 QML92_RS10410 WP_000799686.1 2043558..2043683(-) (comC/comC2) [Streptococcus pneumoniae strain PZ900700792]
MKNTVKLEQFVALKEKDLQKIKGGEMRISRIILDFLFLRKK
MKNTVKLEQFVALKEKDLQKIKGGEMRISRIILDFLFLRKK
Nucleotide
Download Length: 126 bp
>NTDB_id=95325 QML92_RS10410 WP_000799686.1 2043558..2043683(-) (comC/comC2) [Streptococcus pneumoniae strain PZ900700792]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC2 | Streptococcus pneumoniae A66 |
100 |
100 |
1 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
100 |
100 |
1 |
| comC/comC1 | Streptococcus pneumoniae R6 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae G54 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae D39 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
80.488 |
100 |
0.805 |
| comC | Streptococcus mitis SK321 |
75.61 |
100 |
0.756 |
| comC | Streptococcus mitis NCTC 12261 |
57.5 |
97.561 |
0.561 |