Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | V8V48_RS05150 | Genome accession | NZ_CP146481 |
| Coordinates | 1068447..1068896 (+) | Length | 149 a.a. |
| NCBI ID | WP_412487018.1 | Uniprot ID | - |
| Organism | Staphylococcus xylosus strain MS1 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1061791..1100555 | 1068447..1068896 | within | 0 |
Gene organization within MGE regions
Location: 1061791..1100555
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| V8V48_RS05085 (V8V48_05085) | - | 1061791..1062837 (-) | 1047 | WP_412487008.1 | tyrosine-type recombinase/integrase | - |
| V8V48_RS05090 (V8V48_05090) | - | 1062824..1063012 (-) | 189 | WP_412487009.1 | hypothetical protein | - |
| V8V48_RS05095 (V8V48_05095) | - | 1063288..1064064 (-) | 777 | WP_412487010.1 | Ltp family lipoprotein | - |
| V8V48_RS05100 (V8V48_05100) | - | 1064340..1065086 (-) | 747 | WP_412487011.1 | XRE family transcriptional regulator | - |
| V8V48_RS05105 (V8V48_05105) | - | 1065251..1065508 (+) | 258 | WP_412487012.1 | DUF739 family protein | - |
| V8V48_RS05110 (V8V48_05110) | - | 1065513..1066273 (+) | 761 | Protein_975 | Rha family transcriptional regulator | - |
| V8V48_RS05115 (V8V48_05115) | - | 1066284..1066493 (+) | 210 | WP_412487013.1 | pathogenicity island protein | - |
| V8V48_RS05120 (V8V48_05120) | - | 1066497..1066790 (+) | 294 | WP_017722684.1 | DUF771 domain-containing protein | - |
| V8V48_RS05125 (V8V48_05125) | - | 1066803..1066976 (+) | 174 | WP_345965825.1 | hypothetical protein | - |
| V8V48_RS05130 (V8V48_05130) | - | 1067056..1067319 (+) | 264 | WP_412487014.1 | DUF1108 family protein | - |
| V8V48_RS05135 (V8V48_05135) | - | 1067259..1067555 (+) | 297 | WP_412487015.1 | hypothetical protein | - |
| V8V48_RS05140 (V8V48_05140) | - | 1067548..1067802 (+) | 255 | WP_412487016.1 | DUF2483 family protein | - |
| V8V48_RS05145 (V8V48_05145) | - | 1067795..1068454 (+) | 660 | WP_412487017.1 | ERF family protein | - |
| V8V48_RS05150 (V8V48_05150) | ssbA | 1068447..1068896 (+) | 450 | WP_412487018.1 | single-stranded DNA-binding protein | Machinery gene |
| V8V48_RS05155 (V8V48_05155) | - | 1068922..1069593 (+) | 672 | WP_412487019.1 | putative HNHc nuclease | - |
| V8V48_RS05160 (V8V48_05160) | - | 1069586..1070317 (+) | 732 | WP_412487020.1 | helix-turn-helix domain-containing protein | - |
| V8V48_RS05165 (V8V48_05165) | - | 1070328..1071101 (+) | 774 | WP_412487021.1 | ATP-binding protein | - |
| V8V48_RS05170 (V8V48_05170) | - | 1071095..1071268 (+) | 174 | WP_412487022.1 | hypothetical protein | - |
| V8V48_RS05175 (V8V48_05175) | - | 1071269..1071487 (+) | 219 | WP_122062668.1 | hypothetical protein | - |
| V8V48_RS05180 (V8V48_05180) | - | 1071498..1071908 (+) | 411 | WP_412487023.1 | RusA family crossover junction endodeoxyribonuclease | - |
| V8V48_RS05185 (V8V48_05185) | - | 1071901..1072098 (+) | 198 | WP_107551283.1 | hypothetical protein | - |
| V8V48_RS05190 (V8V48_05190) | - | 1072111..1072482 (+) | 372 | WP_412487024.1 | SA1788 family PVL leukocidin-associated protein | - |
| V8V48_RS05195 (V8V48_05195) | - | 1072690..1073025 (-) | 336 | WP_107551281.1 | DUF4870 domain-containing protein | - |
| V8V48_RS05200 (V8V48_05200) | - | 1073144..1073314 (+) | 171 | WP_412487063.1 | DUF1381 domain-containing protein | - |
| V8V48_RS05205 (V8V48_05205) | rinB | 1073344..1073490 (+) | 147 | WP_158262913.1 | transcriptional activator RinB | - |
| V8V48_RS05210 (V8V48_05210) | - | 1073504..1073752 (+) | 249 | WP_412487025.1 | hypothetical protein | - |
| V8V48_RS05215 (V8V48_05215) | - | 1073811..1074209 (+) | 399 | WP_412487026.1 | hypothetical protein | - |
| V8V48_RS05220 (V8V48_05220) | - | 1074801..1075127 (+) | 327 | WP_277582889.1 | HNH endonuclease | - |
| V8V48_RS05225 (V8V48_05225) | - | 1075227..1075535 (+) | 309 | WP_017722721.1 | P27 family phage terminase small subunit | - |
| V8V48_RS05230 (V8V48_05230) | - | 1075525..1077219 (+) | 1695 | WP_017722722.1 | terminase large subunit | - |
| V8V48_RS05235 (V8V48_05235) | - | 1077223..1078494 (+) | 1272 | WP_412487027.1 | phage portal protein | - |
| V8V48_RS05240 (V8V48_05240) | - | 1078445..1079206 (+) | 762 | WP_412487028.1 | head maturation protease, ClpP-related | - |
| V8V48_RS05245 (V8V48_05245) | - | 1079219..1080394 (+) | 1176 | WP_412487029.1 | phage major capsid protein | - |
| V8V48_RS05250 (V8V48_05250) | - | 1080467..1080754 (+) | 288 | WP_412487030.1 | head-tail connector protein | - |
| V8V48_RS05255 (V8V48_05255) | - | 1080760..1081095 (+) | 336 | WP_412487031.1 | hypothetical protein | - |
| V8V48_RS05260 (V8V48_05260) | - | 1081088..1081513 (+) | 426 | WP_412487032.1 | hypothetical protein | - |
| V8V48_RS05265 (V8V48_05265) | - | 1081510..1081905 (+) | 396 | WP_412487033.1 | hypothetical protein | - |
| V8V48_RS05270 (V8V48_05270) | - | 1081939..1082571 (+) | 633 | WP_412487034.1 | major tail protein | - |
| V8V48_RS05275 (V8V48_05275) | - | 1082667..1083197 (+) | 531 | WP_412487035.1 | Ig-like domain-containing protein | - |
| V8V48_RS05280 (V8V48_05280) | gpG | 1083265..1083615 (+) | 351 | WP_326009758.1 | phage tail assembly chaperone G | - |
| V8V48_RS05285 (V8V48_05285) | - | 1083657..1083821 (+) | 165 | WP_412487036.1 | hypothetical protein | - |
| V8V48_RS05290 (V8V48_05290) | - | 1083844..1090608 (+) | 6765 | WP_412487037.1 | phage tail tape measure protein | - |
| V8V48_RS05295 (V8V48_05295) | - | 1090622..1091458 (+) | 837 | WP_412487038.1 | phage tail domain-containing protein | - |
| V8V48_RS05300 (V8V48_05300) | - | 1091468..1093054 (+) | 1587 | WP_412487039.1 | prophage endopeptidase tail family protein | - |
| V8V48_RS05305 (V8V48_05305) | - | 1093047..1093616 (+) | 570 | WP_412487040.1 | hypothetical protein | - |
| V8V48_RS05310 (V8V48_05310) | - | 1093630..1096299 (+) | 2670 | WP_412487041.1 | peptidase G2 autoproteolytic cleavage domain-containing protein | - |
| V8V48_RS05315 (V8V48_05315) | - | 1096311..1097849 (+) | 1539 | WP_412487042.1 | hypothetical protein | - |
| V8V48_RS05320 (V8V48_05320) | - | 1097862..1098269 (+) | 408 | WP_412487043.1 | hypothetical protein | - |
| V8V48_RS05325 (V8V48_05325) | - | 1098273..1098425 (+) | 153 | WP_107558704.1 | XkdX family protein | - |
| V8V48_RS05330 (V8V48_05330) | - | 1098463..1098771 (+) | 309 | WP_142401615.1 | hypothetical protein | - |
| V8V48_RS05335 (V8V48_05335) | - | 1098824..1099135 (+) | 312 | WP_107556224.1 | holin | - |
| V8V48_RS05340 (V8V48_05340) | - | 1099188..1100555 (+) | 1368 | WP_412487044.1 | SH3 domain-containing protein | - |
Sequence
Protein
Download Length: 149 a.a. Molecular weight: 16588.31 Da Isoelectric Point: 7.0167
>NTDB_id=942839 V8V48_RS05150 WP_412487018.1 1068447..1068896(+) (ssbA) [Staphylococcus xylosus strain MS1]
MINRVVLVGRLTKDPEFRTTPSGVNIANFTLAVNRTFTNAQGEREADFINVVVFRKQAENVNNYLFKGHLAGVDGRIQSR
SYENKEGQRVFVTEVVADSVQFLEPKNNGQANNVSKGQQTGTNNQRSSNDNPFANNNGPIDIKDDDLPF
MINRVVLVGRLTKDPEFRTTPSGVNIANFTLAVNRTFTNAQGEREADFINVVVFRKQAENVNNYLFKGHLAGVDGRIQSR
SYENKEGQRVFVTEVVADSVQFLEPKNNGQANNVSKGQQTGTNNQRSSNDNPFANNNGPIDIKDDDLPF
Nucleotide
Download Length: 450 bp
>NTDB_id=942839 V8V48_RS05150 WP_412487018.1 1068447..1068896(+) (ssbA) [Staphylococcus xylosus strain MS1]
ATGATTAATAGAGTTGTATTAGTAGGACGTTTAACGAAAGACCCAGAATTCAGAACAACACCATCTGGTGTAAATATTGC
AAACTTCACCTTAGCTGTTAATAGAACATTTACAAATGCACAAGGTGAACGAGAAGCAGACTTTATCAATGTAGTTGTTT
TCCGTAAACAAGCAGAAAATGTAAACAATTATTTATTCAAAGGTCATTTAGCTGGTGTTGATGGTCGTATTCAATCACGT
AGCTATGAGAATAAAGAGGGGCAACGTGTGTTTGTTACAGAAGTTGTCGCAGACAGTGTTCAATTCTTGGAACCAAAAAA
CAACGGACAGGCAAACAACGTATCTAAAGGACAACAGACAGGCACGAATAACCAACGTTCAAGCAATGATAACCCATTTG
CTAATAACAATGGACCTATTGATATTAAAGATGATGATTTACCATTTTAA
ATGATTAATAGAGTTGTATTAGTAGGACGTTTAACGAAAGACCCAGAATTCAGAACAACACCATCTGGTGTAAATATTGC
AAACTTCACCTTAGCTGTTAATAGAACATTTACAAATGCACAAGGTGAACGAGAAGCAGACTTTATCAATGTAGTTGTTT
TCCGTAAACAAGCAGAAAATGTAAACAATTATTTATTCAAAGGTCATTTAGCTGGTGTTGATGGTCGTATTCAATCACGT
AGCTATGAGAATAAAGAGGGGCAACGTGTGTTTGTTACAGAAGTTGTCGCAGACAGTGTTCAATTCTTGGAACCAAAAAA
CAACGGACAGGCAAACAACGTATCTAAAGGACAACAGACAGGCACGAATAACCAACGTTCAAGCAATGATAACCCATTTG
CTAATAACAATGGACCTATTGATATTAAAGATGATGATTTACCATTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
61.143 |
100 |
0.718 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.765 |
100 |
0.591 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.559 |
74.497 |
0.436 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
40.268 |
100 |
0.403 |
| ssbA | Streptococcus mutans UA159 |
36.913 |
100 |
0.369 |
| ssb | Vibrio cholerae strain A1552 |
31.214 |
100 |
0.362 |