Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | SGN29_RS09760 | Genome accession | NZ_CP138576 |
| Coordinates | 1992896..1993366 (-) | Length | 156 a.a. |
| NCBI ID | WP_000934760.1 | Uniprot ID | A0AAN2D761 |
| Organism | Staphylococcus aureus strain MFDS1022333 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1961883..2015548 | 1992896..1993366 | within | 0 |
Gene organization within MGE regions
Location: 1961883..2015548
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SGN29_RS09530 | scn | 1961883..1962233 (-) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| SGN29_RS09535 | - | 1962744..1963082 (-) | 339 | Protein_1837 | SH3 domain-containing protein | - |
| SGN29_RS09540 | sak | 1963730..1964221 (-) | 492 | WP_000920038.1 | staphylokinase | - |
| SGN29_RS09545 | - | 1964412..1965167 (-) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| SGN29_RS09550 | - | 1965179..1965433 (-) | 255 | WP_000611512.1 | phage holin | - |
| SGN29_RS09555 | - | 1965485..1965592 (+) | 108 | WP_031762631.1 | hypothetical protein | - |
| SGN29_RS09560 | pepG1 | 1965645..1965779 (-) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| SGN29_RS09565 | sea | 1965930..1966703 (-) | 774 | WP_000750412.1 | staphylococcal enterotoxin type A | - |
| SGN29_RS09570 | - | 1967076..1967450 (-) | 375 | WP_000340977.1 | hypothetical protein | - |
| SGN29_RS09575 | - | 1967506..1967793 (-) | 288 | WP_001262621.1 | hypothetical protein | - |
| SGN29_RS09580 | - | 1967839..1967991 (-) | 153 | WP_001000058.1 | hypothetical protein | - |
| SGN29_RS09585 | - | 1967984..1971766 (-) | 3783 | WP_000582129.1 | phage tail spike protein | - |
| SGN29_RS09590 | - | 1971782..1973272 (-) | 1491 | WP_001154317.1 | phage distal tail protein | - |
| SGN29_RS09595 | - | 1973272..1977921 (-) | 4650 | WP_001133523.1 | phage tail tape measure protein | - |
| SGN29_RS09600 | gpGT | 1977977..1978099 (-) | 123 | WP_000571956.1 | phage tail assembly chaperone GT | - |
| SGN29_RS09605 | gpG | 1978159..1978605 (-) | 447 | WP_000442605.1 | phage tail assembly chaperone G | - |
| SGN29_RS09610 | - | 1978672..1979625 (-) | 954 | WP_000570648.1 | major tail protein | - |
| SGN29_RS09615 | - | 1979626..1980006 (-) | 381 | WP_000608371.1 | hypothetical protein | - |
| SGN29_RS09620 | - | 1980003..1980380 (-) | 378 | WP_000501242.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| SGN29_RS09625 | - | 1980380..1980715 (-) | 336 | WP_000975314.1 | head-tail adaptor protein | - |
| SGN29_RS09630 | - | 1980702..1981034 (-) | 333 | WP_001177483.1 | head-tail connector protein | - |
| SGN29_RS09635 | - | 1981043..1981201 (-) | 159 | WP_001252099.1 | hypothetical protein | - |
| SGN29_RS09640 | - | 1981237..1982484 (-) | 1248 | WP_000849950.1 | phage major capsid protein | - |
| SGN29_RS09645 | - | 1982572..1983156 (-) | 585 | WP_000032525.1 | HK97 family phage prohead protease | - |
| SGN29_RS09650 | - | 1983149..1984399 (-) | 1251 | WP_000511067.1 | phage portal protein | - |
| SGN29_RS09655 | - | 1984405..1984605 (-) | 201 | WP_000365299.1 | hypothetical protein | - |
| SGN29_RS09660 | - | 1984619..1986313 (-) | 1695 | WP_000133304.1 | terminase large subunit | - |
| SGN29_RS09665 | - | 1986316..1986783 (-) | 468 | WP_000919026.1 | phage terminase small subunit P27 family | - |
| SGN29_RS09670 | - | 1986912..1987256 (-) | 345 | WP_000817289.1 | HNH endonuclease | - |
| SGN29_RS09675 | - | 1987272..1987724 (-) | 453 | WP_000406191.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| SGN29_RS09680 | - | 1987839..1988309 (-) | 471 | WP_000282755.1 | hypothetical protein | - |
| SGN29_RS09685 | - | 1988332..1988532 (-) | 201 | WP_001570807.1 | DUF1514 family protein | - |
| SGN29_RS09690 | rinB | 1988532..1988657 (-) | 126 | WP_031783376.1 | transcriptional activator RinB | - |
| SGN29_RS09695 | - | 1988650..1988853 (-) | 204 | WP_001072793.1 | hypothetical protein | - |
| SGN29_RS09700 | - | 1988854..1989045 (-) | 192 | Protein_1870 | hypothetical protein | - |
| SGN29_RS09705 | - | 1989042..1989248 (-) | 207 | WP_000195826.1 | DUF1381 domain-containing protein | - |
| SGN29_RS09710 | - | 1989285..1989818 (-) | 534 | WP_025920701.1 | dUTP diphosphatase | - |
| SGN29_RS09715 | - | 1989833..1989994 (-) | 162 | WP_000889683.1 | hypothetical protein | - |
| SGN29_RS09720 | - | 1989995..1990276 (-) | 282 | WP_000454994.1 | hypothetical protein | - |
| SGN29_RS09725 | - | 1990277..1990450 (-) | 174 | WP_000028424.1 | hypothetical protein | - |
| SGN29_RS09730 | - | 1990440..1990691 (-) | 252 | WP_025174939.1 | DUF1024 family protein | - |
| SGN29_RS09735 | - | 1990706..1990948 (-) | 243 | WP_000131381.1 | phi PVL orf 51-like protein | - |
| SGN29_RS09740 | - | 1990952..1991322 (-) | 371 | Protein_1878 | SA1788 family PVL leukocidin-associated protein | - |
| SGN29_RS09745 | - | 1991335..1991739 (-) | 405 | WP_000401978.1 | RusA family crossover junction endodeoxyribonuclease | - |
| SGN29_RS09750 | - | 1991748..1991966 (-) | 219 | WP_000338527.1 | hypothetical protein | - |
| SGN29_RS09755 | - | 1991973..1992866 (-) | 894 | WP_000148335.1 | DnaD domain-containing protein | - |
| SGN29_RS09760 | ssbA | 1992896..1993366 (-) | 471 | WP_000934760.1 | single-stranded DNA-binding protein | Machinery gene |
| SGN29_RS09765 | - | 1993367..1993984 (-) | 618 | WP_071621397.1 | MBL fold metallo-hydrolase | - |
| SGN29_RS09770 | - | 1994065..1994985 (-) | 921 | WP_000138475.1 | recombinase RecT | - |
| SGN29_RS09775 | - | 1994987..1996930 (-) | 1944 | WP_031783377.1 | AAA family ATPase | - |
| SGN29_RS09780 | - | 1996939..1997202 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| SGN29_RS09785 | - | 1997211..1997471 (-) | 261 | WP_000291488.1 | DUF1108 family protein | - |
| SGN29_RS09790 | - | 1997564..1997725 (-) | 162 | WP_000066020.1 | DUF1270 domain-containing protein | - |
| SGN29_RS09795 | - | 1997722..1998042 (-) | 321 | WP_001120197.1 | DUF771 domain-containing protein | - |
| SGN29_RS09800 | - | 1998101..1998733 (+) | 633 | WP_000275058.1 | hypothetical protein | - |
| SGN29_RS09805 | - | 1998748..1998888 (-) | 141 | WP_000939496.1 | hypothetical protein | - |
| SGN29_RS09810 | - | 1998919..1999116 (-) | 198 | WP_001148861.1 | hypothetical protein | - |
| SGN29_RS09815 | - | 1999132..1999881 (-) | 750 | WP_001148337.1 | phage antirepressor KilAC domain-containing protein | - |
| SGN29_RS09820 | - | 1999938..2000477 (+) | 540 | WP_000351243.1 | hypothetical protein | - |
| SGN29_RS09825 | - | 2000501..2000761 (-) | 261 | WP_000435341.1 | transcriptional regulator | - |
| SGN29_RS09830 | - | 2000779..2001003 (-) | 225 | WP_000338185.1 | DUF739 family protein | - |
| SGN29_RS09835 | - | 2001162..2001932 (+) | 771 | WP_031783378.1 | S24 family peptidase | - |
| SGN29_RS09840 | - | 2002132..2002314 (+) | 183 | WP_000705240.1 | hypothetical protein | - |
| SGN29_RS09845 | - | 2002350..2002496 (+) | 147 | WP_001013104.1 | hypothetical protein | - |
| SGN29_RS09850 | - | 2002493..2003107 (-) | 615 | WP_000191459.1 | hypothetical protein | - |
| SGN29_RS09855 | - | 2003215..2004252 (+) | 1038 | WP_000857176.1 | site-specific integrase | - |
| SGN29_RS09860 | sph | 2004309..2005133 (+) | 825 | Protein_1902 | sphingomyelin phosphodiesterase | - |
| SGN29_RS09865 | lukG | 2005634..2006650 (-) | 1017 | WP_000595401.1 | bi-component leukocidin LukGH subunit G | - |
| SGN29_RS09870 | lukH | 2006672..2007724 (-) | 1053 | WP_000791404.1 | bi-component leukocidin LukGH subunit H | - |
| SGN29_RS09875 | - | 2008160..2009383 (+) | 1224 | WP_000206635.1 | ArgE/DapE family deacylase | - |
| SGN29_RS09880 | - | 2009756..2010600 (-) | 845 | Protein_1906 | class I SAM-dependent methyltransferase | - |
| SGN29_RS09885 | - | 2010662..2011573 (-) | 912 | WP_000825510.1 | iron-hydroxamate ABC transporter substrate-binding protein | - |
| SGN29_RS09890 | - | 2011734..2013041 (+) | 1308 | WP_001045085.1 | TrkH family potassium uptake protein | - |
| SGN29_RS09895 | groL | 2013572..2015188 (-) | 1617 | WP_000240645.1 | chaperonin GroEL | - |
| SGN29_RS09900 | groES | 2015264..2015548 (-) | 285 | WP_000917289.1 | co-chaperone GroES | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17641.52 Da Isoelectric Point: 5.2672
>NTDB_id=903607 SGN29_RS09760 WP_000934760.1 1992896..1993366(-) (ssbA) [Staphylococcus aureus strain MFDS1022333]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=903607 SGN29_RS09760 WP_000934760.1 1992896..1993366(-) (ssbA) [Staphylococcus aureus strain MFDS1022333]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTGA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.768 |
100 |
0.372 |
| ssb | Neisseria meningitidis MC58 |
32.948 |
100 |
0.365 |
| ssb | Neisseria gonorrhoeae MS11 |
32.948 |
100 |
0.365 |