Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | LPC25_RS10315 | Genome accession | NZ_AP025176 |
| Coordinates | 2079848..2080318 (-) | Length | 156 a.a. |
| NCBI ID | WP_000610650.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain TPS5614 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2051363..2105272 | 2079848..2080318 | within | 0 |
Gene organization within MGE regions
Location: 2051363..2105272
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LPC25_RS10125 (TPS5614TP_19060) | scn | 2051363..2051713 (-) | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
| LPC25_RS10130 (TPS5614TP_19070) | - | 2052395..2052844 (+) | 450 | WP_000727643.1 | chemotaxis-inhibiting protein CHIPS | - |
| LPC25_RS10135 | - | 2052937..2053274 (-) | 338 | Protein_1968 | SH3 domain-containing protein | - |
| LPC25_RS10140 (TPS5614TP_19090) | sak | 2053922..2054413 (-) | 492 | WP_000920041.1 | staphylokinase | - |
| LPC25_RS10145 (TPS5614TP_19100) | - | 2054604..2055359 (-) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| LPC25_RS10150 (TPS5614TP_19110) | - | 2055371..2055625 (-) | 255 | WP_000611512.1 | phage holin | - |
| LPC25_RS10155 | - | 2055677..2055784 (+) | 108 | WP_031762631.1 | hypothetical protein | - |
| LPC25_RS10160 (TPS5614TP_19120) | pepG1 | 2055837..2055971 (-) | 135 | WP_000880504.1 | type I toxin-antitoxin system toxin PepG1 | - |
| LPC25_RS10165 (TPS5614TP_19130) | - | 2056165..2056461 (-) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| LPC25_RS10170 (TPS5614TP_19140) | - | 2056519..2056806 (-) | 288 | WP_001040261.1 | hypothetical protein | - |
| LPC25_RS10175 (TPS5614TP_19150) | - | 2056853..2057005 (-) | 153 | WP_001153681.1 | hypothetical protein | - |
| LPC25_RS10180 (TPS5614TP_19160) | - | 2056995..2060780 (-) | 3786 | WP_000582148.1 | phage tail spike protein | - |
| LPC25_RS10185 (TPS5614TP_19170) | - | 2060796..2062280 (-) | 1485 | WP_000567408.1 | phage distal tail protein | - |
| LPC25_RS10190 (TPS5614TP_19180) | - | 2062277..2066806 (-) | 4530 | WP_001805631.1 | phage tail tape measure protein | - |
| LPC25_RS14130 (TPS5614TP_19190) | gpGT | 2066863..2067000 (-) | 138 | WP_001549167.1 | phage tail assembly chaperone GT | - |
| LPC25_RS10195 (TPS5614TP_19200) | gpG | 2067051..2067401 (-) | 351 | WP_001096355.1 | phage tail assembly chaperone G | - |
| LPC25_RS10200 (TPS5614TP_19210) | - | 2067451..2067675 (-) | 225 | WP_071621395.1 | Ig-like domain-containing protein | - |
| LPC25_RS10205 (TPS5614TP_19220) | - | 2067717..2068361 (-) | 645 | WP_000268739.1 | major tail protein | - |
| LPC25_RS10210 (TPS5614TP_19230) | - | 2068362..2068769 (-) | 408 | WP_000565498.1 | hypothetical protein | - |
| LPC25_RS10215 (TPS5614TP_19240) | - | 2068766..2069170 (-) | 405 | WP_000114225.1 | HK97 gp10 family phage protein | - |
| LPC25_RS10220 (TPS5614TP_19250) | - | 2069167..2069529 (-) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| LPC25_RS10225 (TPS5614TP_19260) | - | 2069513..2069797 (-) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| LPC25_RS10230 (TPS5614TP_19270) | - | 2069787..2070071 (-) | 285 | WP_000238236.1 | hypothetical protein | - |
| LPC25_RS10235 (TPS5614TP_19280) | - | 2070091..2071236 (-) | 1146 | WP_000154555.1 | phage major capsid protein | - |
| LPC25_RS10240 (TPS5614TP_19290) | - | 2071260..2071997 (-) | 738 | WP_000642728.1 | head maturation protease, ClpP-related | - |
| LPC25_RS10245 (TPS5614TP_19300) | - | 2071981..2073168 (-) | 1188 | WP_000025274.1 | phage portal protein | - |
| LPC25_RS10250 (TPS5614TP_19310) | - | 2073184..2074845 (-) | 1662 | WP_000625088.1 | terminase large subunit | - |
| LPC25_RS10255 (TPS5614TP_19320) | - | 2074842..2075186 (-) | 345 | WP_000402904.1 | hypothetical protein | - |
| LPC25_RS10260 (TPS5614TP_19330) | - | 2075317..2075616 (-) | 300 | WP_000988332.1 | HNH endonuclease | - |
| LPC25_RS10265 (TPS5614TP_19340) | - | 2075848..2076264 (-) | 417 | WP_000590122.1 | hypothetical protein | - |
| LPC25_RS10270 (TPS5614TP_19350) | - | 2076292..2076492 (-) | 201 | WP_000265042.1 | DUF1514 family protein | - |
| LPC25_RS10275 (TPS5614TP_19360) | - | 2076612..2076866 (-) | 255 | WP_000370292.1 | DUF1024 family protein | - |
| LPC25_RS10280 (TPS5614TP_19370) | - | 2076859..2077086 (-) | 228 | Protein_1998 | hypothetical protein | - |
| LPC25_RS10285 (TPS5614TP_19380) | - | 2077140..2077589 (-) | 450 | WP_000982708.1 | YopX family protein | - |
| LPC25_RS10290 (TPS5614TP_19390) | - | 2077654..2077902 (-) | 249 | WP_001126836.1 | phi PVL orf 51-like protein | - |
| LPC25_RS10295 (TPS5614TP_19400) | - | 2077903..2078274 (-) | 372 | WP_000101268.1 | SA1788 family PVL leukocidin-associated protein | - |
| LPC25_RS10300 (TPS5614TP_19410) | - | 2078287..2078691 (-) | 405 | WP_000401976.1 | RusA family crossover junction endodeoxyribonuclease | - |
| LPC25_RS10305 (TPS5614TP_19420) | - | 2078700..2078918 (-) | 219 | WP_101244998.1 | hypothetical protein | - |
| LPC25_RS10310 (TPS5614TP_19430) | - | 2078925..2079818 (-) | 894 | WP_000148326.1 | DnaD domain protein | - |
| LPC25_RS10315 (TPS5614TP_19440) | ssbA | 2079848..2080318 (-) | 471 | WP_000610650.1 | single-stranded DNA-binding protein | Machinery gene |
| LPC25_RS10320 (TPS5614TP_19450) | - | 2080319..2080936 (-) | 618 | WP_073394849.1 | MBL fold metallo-hydrolase | - |
| LPC25_RS10325 (TPS5614TP_19460) | - | 2081017..2081937 (-) | 921 | WP_101244999.1 | recombinase RecT | - |
| LPC25_RS10330 (TPS5614TP_19470) | - | 2081939..2083882 (-) | 1944 | WP_000700560.1 | AAA family ATPase | - |
| LPC25_RS10335 (TPS5614TP_19480) | - | 2083891..2084154 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| LPC25_RS10340 (TPS5614TP_19490) | - | 2084163..2084423 (-) | 261 | WP_000291488.1 | DUF1108 family protein | - |
| LPC25_RS10345 (TPS5614TP_19500) | - | 2084516..2084677 (-) | 162 | WP_000066020.1 | DUF1270 domain-containing protein | - |
| LPC25_RS10350 (TPS5614TP_19510) | - | 2084674..2084994 (-) | 321 | WP_001120197.1 | DUF771 domain-containing protein | - |
| LPC25_RS10355 (TPS5614TP_19520) | - | 2085053..2085685 (+) | 633 | WP_000275058.1 | hypothetical protein | - |
| LPC25_RS10360 (TPS5614TP_19530) | - | 2085700..2085840 (-) | 141 | WP_000939496.1 | hypothetical protein | - |
| LPC25_RS10365 | - | 2085871..2086068 (-) | 198 | Protein_2015 | hypothetical protein | - |
| LPC25_RS10370 (TPS5614TP_19540) | - | 2086084..2086836 (-) | 753 | WP_024928163.1 | phage antirepressor KilAC domain-containing protein | - |
| LPC25_RS10375 (TPS5614TP_19550) | - | 2086893..2087432 (+) | 540 | WP_000351243.1 | hypothetical protein | - |
| LPC25_RS10380 (TPS5614TP_19560) | - | 2087456..2087716 (-) | 261 | WP_000435341.1 | transcriptional regulator | - |
| LPC25_RS10385 (TPS5614TP_19570) | - | 2087734..2087958 (-) | 225 | WP_000338186.1 | DUF739 family protein | - |
| LPC25_RS10390 (TPS5614TP_19580) | - | 2088117..2088887 (+) | 771 | WP_001208482.1 | S24 family peptidase | - |
| LPC25_RS10395 (TPS5614TP_19590) | - | 2089087..2089269 (+) | 183 | WP_000694772.1 | hypothetical protein | - |
| LPC25_RS10400 (TPS5614TP_19600) | - | 2089305..2089451 (+) | 147 | WP_001013104.1 | hypothetical protein | - |
| LPC25_RS10405 (TPS5614TP_19610) | - | 2089448..2090062 (-) | 615 | WP_000191460.1 | hypothetical protein | - |
| LPC25_RS10410 (TPS5614TP_19620) | - | 2090170..2091207 (+) | 1038 | WP_000857176.1 | tyrosine-type recombinase/integrase | - |
| LPC25_RS10415 (TPS5614TP_19630) | sph | 2091264..2092088 (+) | 825 | Protein_2025 | sphingomyelin phosphodiesterase | - |
| LPC25_RS10420 (TPS5614TP_19640) | lukG | 2092326..2093342 (-) | 1017 | WP_000595402.1 | bi-component leukocidin LukGH subunit G | - |
| LPC25_RS10425 (TPS5614TP_19650) | lukH | 2093364..2094416 (-) | 1053 | WP_000791416.1 | bi-component leukocidin LukGH subunit H | - |
| LPC25_RS10430 (TPS5614TP_19660) | - | 2094851..2096074 (+) | 1224 | WP_000206641.1 | ArgE/DapE family deacylase | - |
| LPC25_RS10435 (TPS5614TP_19670) | - | 2096446..2097291 (-) | 846 | WP_000812008.1 | class I SAM-dependent methyltransferase | - |
| LPC25_RS10440 (TPS5614TP_19680) | - | 2097353..2098264 (-) | 912 | WP_000825510.1 | iron-hydroxamate ABC transporter substrate-binding protein | - |
| LPC25_RS10445 (TPS5614TP_19690) | - | 2098425..2099732 (+) | 1308 | WP_001045063.1 | TrkH family potassium uptake protein | - |
| LPC25_RS10450 (TPS5614TP_19700) | groL | 2100269..2101885 (-) | 1617 | WP_000240649.1 | chaperonin GroEL | - |
| LPC25_RS10455 (TPS5614TP_19710) | groES | 2101961..2102245 (-) | 285 | WP_000917289.1 | co-chaperone GroES | - |
| LPC25_RS10460 (TPS5614TP_19720) | mroQ | 2102422..2103165 (+) | 744 | WP_000197645.1 | CPBP family intramembrane glutamic endopeptidase MroQ | - |
| LPC25_RS10465 (TPS5614TP_19730) | - | 2103190..2104449 (-) | 1260 | WP_000120317.1 | SdrH family protein | - |
| LPC25_RS10470 (TPS5614TP_19740) | - | 2104646..2105272 (+) | 627 | WP_000522384.1 | nitroreductase family protein | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17658.50 Da Isoelectric Point: 4.9628
>NTDB_id=90294 LPC25_RS10315 WP_000610650.1 2079848..2080318(-) (ssbA) [Staphylococcus aureus strain TPS5614]
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINVIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDDDLPF
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINVIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=90294 LPC25_RS10315 WP_000610650.1 2079848..2080318(-) (ssbA) [Staphylococcus aureus strain TPS5614]
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAATCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATAAATGTCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACGATGATTTACCATTCTAA
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAATCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATAAATGTCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACGATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.367 |
100 |
0.628 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.765 |
100 |
0.564 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Vibrio cholerae strain A1552 |
31.492 |
100 |
0.365 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |