Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   R5U33_RS06190 Genome accession   NZ_CP137461
Coordinates   1274078..1274563 (-) Length   161 a.a.
NCBI ID   WP_002346391.1    Uniprot ID   -
Organism   Enterococcus faecium strain C10-7     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1249100..1295377 1274078..1274563 within 0


Gene organization within MGE regions


Location: 1249100..1295377
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R5U33_RS06010 (R5U33_06010) - 1249100..1249402 (+) 303 WP_002333318.1 DUF5960 family protein -
  R5U33_RS06020 (R5U33_06020) - 1250182..1251198 (-) 1017 WP_317910557.1 N-acetylmuramoyl-L-alanine amidase -
  R5U33_RS06025 (R5U33_06025) - 1251209..1251406 (-) 198 WP_002314481.1 phage holin -
  R5U33_RS06030 (R5U33_06030) - 1251430..1251723 (-) 294 WP_002343519.1 hypothetical protein -
  R5U33_RS06035 (R5U33_06035) - 1251761..1251898 (-) 138 WP_002343518.1 XkdX family protein -
  R5U33_RS06040 (R5U33_06040) - 1251900..1252346 (-) 447 WP_317910558.1 hypothetical protein -
  R5U33_RS06045 (R5U33_06045) - 1252352..1254532 (-) 2181 WP_317910559.1 BppU family phage baseplate upper protein -
  R5U33_RS06050 (R5U33_06050) - 1254532..1255578 (-) 1047 WP_317910560.1 hypothetical protein -
  R5U33_RS06055 (R5U33_06055) - 1255578..1256597 (-) 1020 WP_317910561.1 phage tail protein -
  R5U33_RS06060 (R5U33_06060) - 1256606..1257436 (-) 831 WP_317910563.1 phage tail family protein -
  R5U33_RS06065 (R5U33_06065) - 1257447..1261307 (-) 3861 WP_317910564.1 tape measure protein -
  R5U33_RS06070 (R5U33_06070) - 1261307..1261498 (-) 192 WP_002339947.1 hypothetical protein -
  R5U33_RS06075 (R5U33_06075) gpG 1261522..1261833 (-) 312 WP_002335843.1 phage tail assembly chaperone G -
  R5U33_RS06080 (R5U33_06080) - 1261958..1262518 (-) 561 WP_010725043.1 major tail protein -
  R5U33_RS06085 (R5U33_06085) - 1262534..1262905 (-) 372 WP_002329393.1 hypothetical protein -
  R5U33_RS06090 (R5U33_06090) - 1262902..1263297 (-) 396 WP_002290643.1 HK97-gp10 family putative phage morphogenesis protein -
  R5U33_RS06095 (R5U33_06095) - 1263294..1263629 (-) 336 WP_002333638.1 phage head closure protein -
  R5U33_RS06100 (R5U33_06100) - 1263607..1263891 (-) 285 WP_002333639.1 head-tail connector protein -
  R5U33_RS06105 (R5U33_06105) - 1263903..1264160 (-) 258 WP_123833253.1 Ig-like domain-containing protein -
  R5U33_RS06110 (R5U33_06110) - 1264157..1265338 (-) 1182 WP_317910566.1 phage major capsid protein -
  R5U33_RS06115 (R5U33_06115) - 1265378..1265923 (-) 546 WP_317910715.1 HK97 family phage prohead protease -
  R5U33_RS06120 (R5U33_06120) - 1265871..1267055 (-) 1185 WP_317910567.1 phage portal protein -
  R5U33_RS06125 (R5U33_06125) - 1267229..1268953 (-) 1725 WP_010726214.1 terminase large subunit -
  R5U33_RS06130 (R5U33_06130) - 1268946..1269425 (-) 480 WP_070551739.1 phage terminase small subunit P27 family -
  R5U33_RS06135 (R5U33_06135) - 1269591..1269965 (-) 375 WP_025479157.1 HNH endonuclease signature motif containing protein -
  R5U33_RS06140 (R5U33_06140) - 1269958..1270158 (-) 201 WP_002343507.1 hypothetical protein -
  R5U33_RS06145 (R5U33_06145) - 1270155..1270385 (-) 231 WP_002343506.1 hypothetical protein -
  R5U33_RS06150 (R5U33_06150) - 1270453..1270917 (-) 465 WP_317910572.1 hypothetical protein -
  R5U33_RS06155 (R5U33_06155) - 1270948..1271898 (-) 951 WP_002332754.1 hypothetical protein -
  R5U33_RS06160 (R5U33_06160) - 1272291..1272707 (-) 417 WP_317910716.1 ArpU family phage packaging/lysis transcriptional regulator -
  R5U33_RS06165 (R5U33_06165) - 1272784..1273080 (-) 297 WP_317910573.1 hypothetical protein -
  R5U33_RS06170 (R5U33_06170) - 1273092..1273280 (-) 189 WP_317910574.1 toxin PIN -
  R5U33_RS06175 (R5U33_06175) - 1273277..1273594 (-) 318 WP_317910575.1 DUF1140 family protein -
  R5U33_RS06180 (R5U33_06180) - 1273594..1273899 (-) 306 WP_079200798.1 hypothetical protein -
  R5U33_RS06185 (R5U33_06185) - 1273896..1274057 (-) 162 WP_317910717.1 antitoxin -
  R5U33_RS06190 (R5U33_06190) ssbA 1274078..1274563 (-) 486 WP_002346391.1 single-stranded DNA-binding protein Machinery gene
  R5U33_RS06195 (R5U33_06195) - 1274564..1274899 (-) 336 WP_002346392.1 VRR-NUC domain-containing protein -
  R5U33_RS06200 (R5U33_06200) - 1274896..1275084 (-) 189 WP_002346393.1 hypothetical protein -
  R5U33_RS06205 (R5U33_06205) - 1275085..1276323 (-) 1239 WP_002346394.1 DnaB-like helicase C-terminal domain-containing protein -
  R5U33_RS06210 (R5U33_06210) - 1276313..1277011 (-) 699 WP_002346395.1 helix-turn-helix domain-containing protein -
  R5U33_RS06215 (R5U33_06215) - 1277014..1277700 (-) 687 WP_002375505.1 putative HNHc nuclease -
  R5U33_RS06220 (R5U33_06220) - 1277706..1278377 (-) 672 WP_002323907.1 DUF1071 domain-containing protein -
  R5U33_RS06225 (R5U33_06225) - 1278370..1278711 (-) 342 WP_002333656.1 hypothetical protein -
  R5U33_RS06230 (R5U33_06230) - 1278885..1279229 (+) 345 WP_104858030.1 hypothetical protein -
  R5U33_RS06235 (R5U33_06235) - 1279212..1279394 (-) 183 WP_104858031.1 hypothetical protein -
  R5U33_RS06240 (R5U33_06240) - 1279438..1279608 (-) 171 WP_010725632.1 hypothetical protein -
  R5U33_RS06245 (R5U33_06245) - 1279657..1279917 (-) 261 WP_002323902.1 hypothetical protein -
  R5U33_RS06255 (R5U33_06255) - 1280057..1280260 (-) 204 WP_010722962.1 hypothetical protein -
  R5U33_RS06260 (R5U33_06260) - 1280275..1281051 (-) 777 WP_002343597.1 phage antirepressor KilAC domain-containing protein -
  R5U33_RS06265 (R5U33_06265) - 1281351..1281671 (+) 321 WP_002290615.1 helix-turn-helix domain-containing protein -
  R5U33_RS06270 (R5U33_06270) - 1281689..1282111 (+) 423 WP_002329428.1 ImmA/IrrE family metallo-endopeptidase -
  R5U33_RS06275 (R5U33_06275) - 1282194..1282829 (+) 636 WP_002329429.1 DUF4352 domain-containing protein -
  R5U33_RS06280 (R5U33_06280) - 1282941..1283594 (+) 654 WP_002293175.1 hypothetical protein -
  R5U33_RS06285 (R5U33_06285) - 1283729..1284400 (+) 672 WP_002346397.1 DUF5067 domain-containing protein -
  R5U33_RS06290 (R5U33_06290) - 1284581..1285237 (-) 657 WP_137214533.1 hypothetical protein -
  R5U33_RS06295 (R5U33_06295) - 1285391..1286539 (+) 1149 WP_002343600.1 site-specific integrase -
  R5U33_RS06305 (R5U33_06305) - 1286878..1287444 (-) 567 WP_002296332.1 TetR/AcrR family transcriptional regulator -
  R5U33_RS06310 (R5U33_06310) - 1287700..1289031 (+) 1332 Protein_1218 DUF1576 domain-containing protein -
  R5U33_RS06315 (R5U33_06315) - 1288997..1289347 (+) 351 WP_002296335.1 hypothetical protein -
  R5U33_RS06320 (R5U33_06320) - 1289439..1289858 (-) 420 WP_002317579.1 cupin domain-containing protein -
  R5U33_RS06325 (R5U33_06325) - 1289859..1290203 (-) 345 WP_002296337.1 carboxymuconolactone decarboxylase family protein -
  R5U33_RS06330 (R5U33_06330) - 1290553..1291149 (+) 597 WP_002287776.1 TVP38/TMEM64 family protein -
  R5U33_RS06335 (R5U33_06335) - 1291273..1293072 (+) 1800 WP_010722599.1 glycerophosphoryl diester phosphodiesterase membrane domain-containing protein -
  R5U33_RS06340 (R5U33_06340) - 1293350..1293562 (-) 213 WP_010722600.1 hypothetical protein -
  R5U33_RS06345 (R5U33_06345) - 1294013..1294162 (+) 150 WP_002293931.1 hypothetical protein -
  R5U33_RS06350 (R5U33_06350) - 1294424..1295377 (-) 954 WP_002325884.1 IS30 family transposase -

Sequence

Protein


Download         Length: 161 a.a.        Molecular weight: 17839.61 Da        Isoelectric Point: 7.9972

>NTDB_id=898053 R5U33_RS06190 WP_002346391.1 1274078..1274563(-) (ssbA) [Enterococcus faecium strain C10-7]
MINTVTLVGRLTKDPELRTTTSGTGVATFTLAVNRDFKDANGNREADFINCVAWRKTAEILANYAKKGSLIGLIGRIQTR
SYENQQGNRVFVTEVVVERFNLLESRSNNDTSVSNNQTTNYKGNNQNSSNDLSHAQNNQSKNVNSNPFDGSSMNTDLELP
F

Nucleotide


Download         Length: 486 bp        

>NTDB_id=898053 R5U33_RS06190 WP_002346391.1 1274078..1274563(-) (ssbA) [Enterococcus faecium strain C10-7]
ATGATTAATACAGTGACTTTAGTAGGAAGATTGACAAAAGACCCAGAGCTTAGAACCACAACAAGTGGAACAGGAGTAGC
GACTTTCACATTAGCAGTAAATCGTGACTTCAAAGATGCGAATGGAAATAGAGAAGCAGACTTTATCAATTGTGTAGCGT
GGAGAAAAACAGCTGAAATTTTAGCAAACTATGCGAAAAAAGGTTCGTTGATTGGATTGATTGGGCGTATTCAAACCAGA
AGCTATGAAAATCAACAAGGAAACCGAGTTTTTGTGACGGAAGTAGTCGTAGAACGCTTCAATCTACTTGAGAGCCGTTC
CAACAACGATACAAGCGTTTCGAACAATCAGACGACAAATTATAAAGGGAACAACCAAAACAGCTCTAACGACTTATCAC
ACGCTCAAAACAATCAATCAAAAAACGTTAATTCCAATCCGTTTGATGGTTCGTCAATGAATACTGATTTAGAACTTCCG
TTTTGA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-102)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

50.581

100

0.54
  ssb Latilactobacillus sakei subsp. sakei 23K

51.176

100

0.54
  ssbB Bacillus subtilis subsp. subtilis str. 168

58.491

65.839

0.385
  ssbB/cilA Streptococcus pneumoniae TIGR4

54.206

66.46

0.36
  ssbB/cilA Streptococcus mitis NCTC 12261

54.206

66.46

0.36