Detailed information
Overview
| Name | comC/comC1 | Type | Regulator |
| Locus tag | R4712_RS05280 | Genome accession | NZ_CP137110 |
| Coordinates | 1041495..1041620 (+) | Length | 41 a.a. |
| NCBI ID | WP_000799689.1 | Uniprot ID | P60242 |
| Organism | Streptococcus pneumoniae strain 16H2041 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1036495..1046620
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| R4712_RS05255 | dnaA | 1036980..1038341 (-) | 1362 | WP_000660615.1 | chromosomal replication initiator protein DnaA | - |
| R4712_RS05260 | spo0J | 1038554..1039312 (-) | 759 | WP_000410383.1 | ParB/RepB/Spo0J family partition protein | Regulator |
| R4712_RS05265 | htrA | 1039370..1040551 (-) | 1182 | WP_000681601.1 | S1C family serine protease | Regulator |
| R4712_RS05270 | rlmH | 1040734..1041213 (+) | 480 | WP_000695929.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| R4712_RS05280 | comC/comC1 | 1041495..1041620 (+) | 126 | WP_000799689.1 | competence-stimulating peptide ComC | Regulator |
| R4712_RS05285 | comD/comD1 | 1041641..1042966 (+) | 1326 | WP_000362880.1 | competence system sensor histidine kinase ComD | Regulator |
| R4712_RS05290 | comE | 1042963..1043715 (+) | 753 | WP_000866065.1 | competence system response regulator transcription factor ComE | Regulator |
| R4712_RS05305 | - | 1043958..1044500 (-) | 543 | WP_001158266.1 | TetR/AcrR family transcriptional regulator | - |
| R4712_RS05310 | - | 1044628..1046281 (+) | 1654 | Protein_1050 | YhgE/Pip family protein | - |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4971.00 Da Isoelectric Point: 11.0775
>NTDB_id=895861 R4712_RS05280 WP_000799689.1 1041495..1041620(+) (comC/comC1) [Streptococcus pneumoniae strain 16H2041]
MKNTVKLEQFVALKEKDLQKIKGGEMRLSKFFRDFILQRKK
MKNTVKLEQFVALKEKDLQKIKGGEMRLSKFFRDFILQRKK
Nucleotide
Download Length: 126 bp
>NTDB_id=895861 R4712_RS05280 WP_000799689.1 1041495..1041620(+) (comC/comC1) [Streptococcus pneumoniae strain 16H2041]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GTTGTCAAAATTCTTCCGTGATTTTATTTTACAAAGAAAAAAGTAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GTTGTCAAAATTCTTCCGTGATTTTATTTTACAAAGAAAAAAGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC1 | Streptococcus pneumoniae R6 |
100 |
100 |
1 |
| comC/comC1 | Streptococcus pneumoniae G54 |
100 |
100 |
1 |
| comC/comC1 | Streptococcus pneumoniae D39 |
100 |
100 |
1 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
100 |
100 |
1 |
| comC/comC2 | Streptococcus pneumoniae A66 |
80.488 |
100 |
0.805 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
80.488 |
100 |
0.805 |
| comC | Streptococcus mitis SK321 |
78.049 |
100 |
0.78 |
| comC | Streptococcus mitis NCTC 12261 |
74.074 |
65.854 |
0.488 |
| comC/blpC | Streptococcus mutans UA159 |
44.444 |
87.805 |
0.39 |