Detailed information
Bioinformatically predicted
Overview
| Name | comC/comC1 | Type | Regulator |
| Locus tag | R4703_RS06010 | Genome accession | NZ_CP137100 |
| Coordinates | 1096939..1097064 (-) | Length | 41 a.a. |
| NCBI ID | WP_050250685.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain LYP | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1091939..1102064
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| R4703_RS05980 | - | 1092775..1093952 (-) | 1178 | Protein_1139 | YhgE/Pip family protein | - |
| R4703_RS05985 | - | 1094059..1094601 (+) | 543 | WP_001158266.1 | TetR/AcrR family transcriptional regulator | - |
| R4703_RS06000 | comE | 1094844..1095596 (-) | 753 | WP_000866065.1 | competence system response regulator transcription factor ComE | Regulator |
| R4703_RS06005 | comD/comD1 | 1095593..1096918 (-) | 1326 | WP_000362880.1 | competence system sensor histidine kinase ComD | Regulator |
| R4703_RS06010 | comC/comC1 | 1096939..1097064 (-) | 126 | WP_050250685.1 | competence-stimulating peptide ComC | Regulator |
| R4703_RS06020 | rlmH | 1097346..1097825 (-) | 480 | WP_000695929.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| R4703_RS06025 | htrA | 1098008..1099189 (+) | 1182 | WP_000681601.1 | S1C family serine protease | Regulator |
| R4703_RS06030 | spo0J | 1099247..1100005 (+) | 759 | WP_000410383.1 | ParB/RepB/Spo0J family partition protein | Regulator |
| R4703_RS06035 | dnaA | 1100218..1101579 (+) | 1362 | WP_000660615.1 | chromosomal replication initiator protein DnaA | - |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4970.02 Da Isoelectric Point: 11.2962
>NTDB_id=895116 R4703_RS06010 WP_050250685.1 1096939..1097064(-) (comC/comC1) [Streptococcus pneumoniae strain LYP]
MKNTVKLEQFVALKEKDLQKIKGGEMRLSKFFRNFILQRKK
MKNTVKLEQFVALKEKDLQKIKGGEMRLSKFFRNFILQRKK
Nucleotide
Download Length: 126 bp
>NTDB_id=895116 R4703_RS06010 WP_050250685.1 1096939..1097064(-) (comC/comC1) [Streptococcus pneumoniae strain LYP]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GTTGTCAAAATTCTTCCGTAATTTTATTTTACAAAGAAAAAAGTAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GTTGTCAAAATTCTTCCGTAATTTTATTTTACAAAGAAAAAAGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC1 | Streptococcus pneumoniae R6 |
97.561 |
100 |
0.976 |
| comC/comC1 | Streptococcus pneumoniae G54 |
97.561 |
100 |
0.976 |
| comC/comC1 | Streptococcus pneumoniae D39 |
97.561 |
100 |
0.976 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
97.561 |
100 |
0.976 |
| comC/comC2 | Streptococcus pneumoniae A66 |
78.049 |
100 |
0.78 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
78.049 |
100 |
0.78 |
| comC | Streptococcus mitis SK321 |
75.61 |
100 |
0.756 |
| comC | Streptococcus mitis NCTC 12261 |
60 |
97.561 |
0.585 |
| comC/blpC | Streptococcus mutans UA159 |
44.444 |
87.805 |
0.39 |