Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   AAC934_RS12680 Genome accession   NZ_CP152362
Coordinates   2476794..2477177 (-) Length   127 a.a.
NCBI ID   WP_038429292.1    Uniprot ID   -
Organism   Bacillus subtilis strain LP     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2471794..2482177
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAC934_RS12640 (AAC934_12640) sinI 2472728..2472901 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  AAC934_RS12645 (AAC934_12645) sinR 2472935..2473270 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  AAC934_RS12650 (AAC934_12650) tasA 2473363..2474148 (-) 786 WP_015714250.1 biofilm matrix protein TasA -
  AAC934_RS12655 (AAC934_12655) sipW 2474212..2474784 (-) 573 WP_003230181.1 signal peptidase I -
  AAC934_RS12660 (AAC934_12660) tapA 2474768..2475529 (-) 762 WP_015714251.1 amyloid fiber anchoring/assembly protein TapA -
  AAC934_RS12665 (AAC934_12665) yqzG 2475801..2476127 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  AAC934_RS12670 (AAC934_12670) spoIIT 2476169..2476348 (-) 180 WP_014480252.1 YqzE family protein -
  AAC934_RS12675 (AAC934_12675) comGG 2476419..2476793 (-) 375 WP_015714252.1 ComG operon protein ComGG Machinery gene
  AAC934_RS12680 (AAC934_12680) comGF 2476794..2477177 (-) 384 WP_038429292.1 ComG operon protein ComGF Machinery gene
  AAC934_RS12685 (AAC934_12685) comGE 2477203..2477550 (-) 348 WP_015714254.1 ComG operon protein 5 Machinery gene
  AAC934_RS12690 (AAC934_12690) comGD 2477534..2477965 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  AAC934_RS12695 (AAC934_12695) comGC 2477955..2478251 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  AAC934_RS12700 (AAC934_12700) comGB 2478265..2479302 (-) 1038 WP_342622981.1 comG operon protein ComGB Machinery gene
  AAC934_RS12705 (AAC934_12705) comGA 2479289..2480359 (-) 1071 WP_015714258.1 competence protein ComGA Machinery gene
  AAC934_RS12710 (AAC934_12710) - 2480621..2480770 (-) 150 WP_250540178.1 hypothetical protein -
  AAC934_RS12715 (AAC934_12715) corA 2480772..2481725 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14547.68 Da        Isoelectric Point: 6.4849

>NTDB_id=892134 AAC934_RS12680 WP_038429292.1 2476794..2477177(-) (comGF) [Bacillus subtilis strain LP]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSRQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADFENGVVLLKIESEDQKVYQTAFPVYSYLGGR

Nucleotide


Download         Length: 384 bp        

>NTDB_id=892134 AAC934_RS12680 WP_038429292.1 2476794..2477177(-) (comGF) [Bacillus subtilis strain LP]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCAGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGAGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

97.619

99.213

0.969