Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | RKV28_RS05850 | Genome accession | NZ_CP134534 |
| Coordinates | 1173081..1173551 (+) | Length | 156 a.a. |
| NCBI ID | WP_000934768.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain KNIH_5618 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1157105..1206327 | 1173081..1173551 | within | 0 |
Gene organization within MGE regions
Location: 1157105..1206327
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RKV28_RS05725 | - | 1157105..1158031 (-) | 927 | WP_000757575.1 | glycerophosphodiester phosphodiesterase | - |
| RKV28_RS05730 | - | 1158270..1158524 (+) | 255 | WP_001049150.1 | YlbG family protein | - |
| RKV28_RS05735 | - | 1158527..1158916 (-) | 390 | WP_000814565.1 | hypothetical protein | - |
| RKV28_RS05740 | rsmD | 1158986..1159528 (+) | 543 | WP_001263796.1 | 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD | - |
| RKV28_RS05745 | coaD | 1159530..1160012 (+) | 483 | WP_000401377.1 | pantetheine-phosphate adenylyltransferase | - |
| RKV28_RS05750 | - | 1160074..1161213 (-) | 1140 | WP_000843611.1 | nucleotidyltransferase | - |
| RKV28_RS05755 | - | 1161340..1161897 (+) | 558 | WP_000872158.1 | DUF177 domain-containing protein | - |
| RKV28_RS05760 | rpmF | 1161977..1162150 (+) | 174 | WP_000290472.1 | 50S ribosomal protein L32 | - |
| RKV28_RS05765 | - | 1162267..1163652 (-) | 1386 | WP_000861313.1 | recombinase family protein | - |
| RKV28_RS05770 | - | 1163859..1164539 (-) | 681 | WP_000392109.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| RKV28_RS05775 | - | 1164571..1165296 (-) | 726 | WP_000661437.1 | PH domain-containing protein | - |
| RKV28_RS05780 | - | 1165324..1165999 (-) | 676 | Protein_1130 | ImmA/IrrE family metallo-endopeptidase | - |
| RKV28_RS05785 | - | 1166016..1166348 (-) | 333 | WP_063456459.1 | helix-turn-helix domain-containing protein | - |
| RKV28_RS05790 | - | 1166611..1166805 (+) | 195 | WP_000108122.1 | helix-turn-helix transcriptional regulator | - |
| RKV28_RS05795 | - | 1166805..1167569 (+) | 765 | WP_001002760.1 | phage antirepressor Ant | - |
| RKV28_RS05800 | - | 1167586..1167780 (+) | 195 | WP_000390105.1 | hypothetical protein | - |
| RKV28_RS05805 | - | 1167984..1168214 (-) | 231 | WP_000395457.1 | hypothetical protein | - |
| RKV28_RS05810 | - | 1168264..1168401 (+) | 138 | WP_000230552.1 | hypothetical protein | - |
| RKV28_RS05815 | - | 1168394..1168561 (+) | 168 | WP_001285957.1 | DUF1270 domain-containing protein | - |
| RKV28_RS05820 | - | 1168562..1168882 (+) | 321 | WP_000219666.1 | hypothetical protein | - |
| RKV28_RS05825 | - | 1168976..1169236 (+) | 261 | WP_000291075.1 | DUF1108 family protein | - |
| RKV28_RS05830 | - | 1169245..1169508 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| RKV28_RS05835 | - | 1169517..1171460 (+) | 1944 | WP_000700555.1 | AAA family ATPase | - |
| RKV28_RS05840 | - | 1171462..1172382 (+) | 921 | WP_000138475.1 | recombinase RecT | - |
| RKV28_RS05845 | - | 1172463..1173080 (+) | 618 | WP_071890040.1 | MBL fold metallo-hydrolase | - |
| RKV28_RS05850 | ssbA | 1173081..1173551 (+) | 471 | WP_000934768.1 | single-stranded DNA-binding protein | Machinery gene |
| RKV28_RS05855 | - | 1173581..1174468 (+) | 888 | WP_044422683.1 | DnaD domain protein | - |
| RKV28_RS05860 | - | 1174475..1174693 (+) | 219 | WP_000338528.1 | hypothetical protein | - |
| RKV28_RS05865 | - | 1174702..1175106 (+) | 405 | WP_000401973.1 | RusA family crossover junction endodeoxyribonuclease | - |
| RKV28_RS05870 | - | 1175119..1175496 (+) | 378 | WP_031875644.1 | SA1788 family PVL leukocidin-associated protein | - |
| RKV28_RS05875 | - | 1175497..1175745 (+) | 249 | WP_001126832.1 | phi PVL orf 51-like protein | - |
| RKV28_RS05880 | - | 1175758..1176159 (+) | 402 | WP_015978402.1 | hypothetical protein | - |
| RKV28_RS05885 | - | 1176156..1176440 (+) | 285 | WP_001105618.1 | hypothetical protein | - |
| RKV28_RS05890 | - | 1176433..1176681 (+) | 249 | WP_001065026.1 | DUF1024 family protein | - |
| RKV28_RS05895 | - | 1176674..1177210 (+) | 537 | WP_031789556.1 | dUTPase | - |
| RKV28_RS05900 | - | 1177247..1177420 (+) | 174 | WP_001209219.1 | hypothetical protein | - |
| RKV28_RS05905 | - | 1177437..1177643 (+) | 207 | WP_031786300.1 | DUF1381 domain-containing protein | - |
| RKV28_RS05910 | - | 1177640..1177834 (+) | 195 | WP_000132920.1 | hypothetical protein | - |
| RKV28_RS05915 | - | 1177831..1178034 (+) | 204 | WP_001072795.1 | hypothetical protein | - |
| RKV28_RS05920 | - | 1178027..1178263 (+) | 237 | WP_000608273.1 | hypothetical protein | - |
| RKV28_RS05925 | - | 1178253..1178639 (+) | 387 | WP_001555739.1 | hypothetical protein | - |
| RKV28_RS05930 | rinB | 1178639..1178812 (+) | 174 | WP_000595244.1 | transcriptional activator RinB | - |
| RKV28_RS05935 | - | 1178813..1178959 (+) | 147 | WP_000990001.1 | hypothetical protein | - |
| RKV28_RS05940 | - | 1178983..1179405 (+) | 423 | WP_000162702.1 | RinA family phage transcriptional activator | - |
| RKV28_RS05945 | - | 1179733..1180227 (+) | 495 | WP_000594082.1 | terminase small subunit | - |
| RKV28_RS05950 | - | 1180220..1181428 (+) | 1209 | WP_001606760.1 | PBSX family phage terminase large subunit | - |
| RKV28_RS05955 | - | 1181442..1182860 (+) | 1419 | WP_225305868.1 | phage portal protein | - |
| RKV28_RS05960 | - | 1182799..1183779 (+) | 981 | WP_001795666.1 | phage head morphogenesis protein | - |
| RKV28_RS05965 | - | 1183877..1184473 (+) | 597 | WP_000366932.1 | phage scaffolding protein | - |
| RKV28_RS05970 | - | 1184494..1185318 (+) | 825 | WP_001135558.1 | N4-gp56 family major capsid protein | - |
| RKV28_RS05975 | - | 1185335..1185661 (+) | 327 | WP_000278799.1 | Rho termination factor N-terminal domain-containing protein | - |
| RKV28_RS05980 | - | 1185661..1185975 (+) | 315 | WP_000338935.1 | phage head-tail connector protein | - |
| RKV28_RS05985 | - | 1185968..1186303 (+) | 336 | WP_000482986.1 | phage head closure protein | - |
| RKV28_RS05990 | - | 1186290..1186703 (+) | 414 | WP_001151335.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| RKV28_RS05995 | - | 1186716..1187153 (+) | 438 | WP_000270196.1 | DUF3168 domain-containing protein | - |
| RKV28_RS06000 | - | 1187140..1187700 (+) | 561 | WP_000046067.1 | hypothetical protein | - |
| RKV28_RS06005 | - | 1187762..1188256 (+) | 495 | WP_000141082.1 | tail assembly chaperone | - |
| RKV28_RS06010 | - | 1188277..1188618 (+) | 342 | WP_001580347.1 | hypothetical protein | - |
| RKV28_RS06015 | - | 1188621..1191590 (+) | 2970 | WP_044425803.1 | terminase | - |
| RKV28_RS06020 | - | 1191605..1192540 (+) | 936 | WP_000560196.1 | phage tail domain-containing protein | - |
| RKV28_RS06025 | - | 1192551..1194437 (+) | 1887 | WP_044425805.1 | SGNH/GDSL hydrolase family protein | - |
| RKV28_RS06030 | - | 1194450..1196348 (+) | 1899 | WP_063664751.1 | hypothetical protein | - |
| RKV28_RS06035 | - | 1196348..1198171 (+) | 1824 | WP_044425642.1 | phage baseplate upper protein | - |
| RKV28_RS06040 | - | 1198171..1198578 (+) | 408 | WP_044425645.1 | DUF2977 domain-containing protein | - |
| RKV28_RS06045 | - | 1198553..1198726 (+) | 174 | WP_001790193.1 | XkdX family protein | - |
| RKV28_RS06050 | - | 1198767..1199066 (+) | 300 | WP_000466769.1 | DUF2951 domain-containing protein | - |
| RKV28_RS14785 | - | 1199203..1199310 (+) | 108 | Protein_1185 | hypothetical protein | - |
| RKV28_RS06055 | - | 1199559..1200179 (+) | 621 | WP_000355823.1 | AP2 domain-containing protein | - |
| RKV28_RS06060 | - | 1200290..1202059 (+) | 1770 | Protein_1187 | glucosaminidase domain-containing protein | - |
| RKV28_RS06065 | - | 1202072..1203244 (+) | 1173 | WP_044435510.1 | BppU family phage baseplate upper protein | - |
| RKV28_RS06070 | - | 1203250..1203645 (+) | 396 | WP_044435513.1 | hypothetical protein | - |
| RKV28_RS06075 | - | 1203701..1204138 (+) | 438 | WP_000354133.1 | phage holin | - |
| RKV28_RS06080 | - | 1204119..1205564 (+) | 1446 | WP_069479479.1 | SH3 domain-containing protein | - |
| RKV28_RS06085 | - | 1205807..1205959 (+) | 153 | WP_001788502.1 | hypothetical protein | - |
| RKV28_RS06090 | - | 1206030..1206140 (+) | 111 | WP_000139423.1 | hypothetical protein | - |
| RKV28_RS06095 | - | 1206142..1206327 (+) | 186 | WP_001286805.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17747.64 Da Isoelectric Point: 4.9816
>NTDB_id=880781 RKV28_RS05850 WP_000934768.1 1173081..1173551(+) (ssbA) [Staphylococcus aureus strain KNIH_5618]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYKQQAQQSRGQSQYPYNKPVKDNPFANANDPIEIDDDDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYKQQAQQSRGQSQYPYNKPVKDNPFANANDPIEIDDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=880781 RKV28_RS05850 WP_000934768.1 1173081..1173551(+) (ssbA) [Staphylococcus aureus strain KNIH_5618]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACAAACAACAAGCGCAACAATCACGTGGACAGTCTCAATATCCATATAACAAAC
CAGTAAAAGATAATCCGTTCGCAAATGCGAATGATCCTATTGAAATAGATGACGATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACAAACAACAAGCGCAACAATCACGTGGACAGTCTCAATATCCATATAACAAAC
CAGTAAAAGATAATCCGTTCGCAAATGCGAATGATCCTATTGAAATAGATGACGATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.367 |
100 |
0.628 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.765 |
100 |
0.564 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Neisseria meningitidis MC58 |
33.526 |
100 |
0.372 |
| ssb | Neisseria gonorrhoeae MS11 |
33.526 |
100 |
0.372 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |