Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | RE424_RS04350 | Genome accession | NZ_CP134047 |
| Coordinates | 888103..888558 (+) | Length | 151 a.a. |
| NCBI ID | WP_268652974.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain 21SAU_AGRO3 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 879053..928204 | 888103..888558 | within | 0 |
Gene organization within MGE regions
Location: 879053..928204
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RE424_RS04265 | sufB | 879053..880450 (+) | 1398 | WP_001074405.1 | Fe-S cluster assembly protein SufB | - |
| RE424_RS04270 | - | 880518..881567 (-) | 1050 | WP_001145738.1 | tyrosine-type recombinase/integrase | - |
| RE424_RS04275 | - | 881680..881859 (+) | 180 | WP_000337826.1 | hypothetical protein | - |
| RE424_RS04280 | - | 881839..882771 (-) | 933 | WP_218763177.1 | hypothetical protein | - |
| RE424_RS04285 | - | 882803..883528 (-) | 726 | WP_268652975.1 | PH domain-containing protein | - |
| RE424_RS04290 | - | 883556..884230 (-) | 675 | WP_000775187.1 | ImmA/IrrE family metallo-endopeptidase | - |
| RE424_RS04295 | - | 884247..884579 (-) | 333 | WP_001055143.1 | helix-turn-helix domain-containing protein | - |
| RE424_RS04300 | - | 884842..885036 (+) | 195 | WP_000108122.1 | helix-turn-helix transcriptional regulator | - |
| RE424_RS04305 | - | 885036..885800 (+) | 765 | WP_001002758.1 | phage antirepressor Ant | - |
| RE424_RS04310 | - | 885817..886011 (+) | 195 | WP_001148858.1 | hypothetical protein | - |
| RE424_RS04315 | - | 886042..886245 (+) | 204 | Protein_832 | hypothetical protein | - |
| RE424_RS04320 | - | 886213..886458 (-) | 246 | WP_000122246.1 | hypothetical protein | - |
| RE424_RS04325 | - | 886529..886750 (+) | 222 | WP_000977378.1 | hypothetical protein | - |
| RE424_RS04330 | - | 886743..886904 (+) | 162 | WP_000066017.1 | DUF1270 domain-containing protein | - |
| RE424_RS04335 | - | 886996..887256 (+) | 261 | WP_000291090.1 | DUF1108 family protein | - |
| RE424_RS04340 | - | 887266..887487 (+) | 222 | WP_000815401.1 | DUF2483 family protein | - |
| RE424_RS04345 | - | 887480..888103 (+) | 624 | WP_000139720.1 | DUF1071 domain-containing protein | - |
| RE424_RS04350 | ssbA | 888103..888558 (+) | 456 | WP_268652974.1 | single-stranded DNA-binding protein | Machinery gene |
| RE424_RS04355 | - | 888570..889265 (+) | 696 | WP_218763183.1 | putative HNHc nuclease | - |
| RE424_RS04360 | - | 889237..890058 (+) | 822 | WP_218763184.1 | phage replisome organizer N-terminal domain-containing protein | - |
| RE424_RS04365 | - | 890071..890856 (+) | 786 | WP_064138656.1 | ATP-binding protein | - |
| RE424_RS04370 | - | 890853..891011 (+) | 159 | WP_064138655.1 | hypothetical protein | - |
| RE424_RS04375 | - | 891024..891245 (+) | 222 | WP_268652973.1 | DUF3269 family protein | - |
| RE424_RS04380 | - | 891256..891660 (+) | 405 | WP_000049810.1 | DUF1064 domain-containing protein | - |
| RE424_RS04385 | - | 891665..891850 (+) | 186 | WP_001187238.1 | DUF3113 family protein | - |
| RE424_RS04390 | - | 891851..892207 (+) | 357 | WP_268652972.1 | SA1788 family PVL leukocidin-associated protein | - |
| RE424_RS04395 | - | 892211..892453 (+) | 243 | WP_000131388.1 | phi PVL orf 51-like protein | - |
| RE424_RS04400 | - | 892468..892716 (+) | 249 | WP_001065093.1 | DUF1024 family protein | - |
| RE424_RS04405 | - | 892709..893248 (+) | 540 | WP_000185698.1 | dUTPase | - |
| RE424_RS04410 | - | 893285..893491 (+) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| RE424_RS04415 | - | 893488..893874 (+) | 387 | WP_268652971.1 | hypothetical protein | - |
| RE424_RS04420 | rinB | 893871..894044 (+) | 174 | WP_000595276.1 | transcriptional activator RinB | - |
| RE424_RS04425 | - | 894045..894191 (+) | 147 | WP_000990006.1 | hypothetical protein | - |
| RE424_RS04430 | - | 894206..894625 (+) | 420 | WP_000058632.1 | transcriptional regulator | - |
| RE424_RS04435 | - | 894812..895252 (+) | 441 | WP_001566315.1 | terminase small subunit | - |
| RE424_RS04440 | - | 895239..896516 (+) | 1278 | WP_000169945.1 | PBSX family phage terminase large subunit | - |
| RE424_RS04445 | - | 896527..898062 (+) | 1536 | WP_268652970.1 | phage portal protein | - |
| RE424_RS04450 | - | 898069..899064 (+) | 996 | WP_310790866.1 | minor capsid protein | - |
| RE424_RS04455 | - | 899137..899307 (+) | 171 | WP_000072208.1 | hypothetical protein | - |
| RE424_RS04460 | - | 899335..899422 (+) | 88 | Protein_861 | hypothetical protein | - |
| RE424_RS04465 | - | 899416..900036 (+) | 621 | WP_000392143.1 | DUF4355 domain-containing protein | - |
| RE424_RS04470 | - | 900050..901024 (+) | 975 | WP_000438512.1 | phage major capsid protein | - |
| RE424_RS04475 | - | 901046..901333 (+) | 288 | WP_001114087.1 | hypothetical protein | - |
| RE424_RS04480 | - | 901342..901674 (+) | 333 | WP_000208959.1 | phage head-tail connector protein | - |
| RE424_RS04485 | - | 901671..901973 (+) | 303 | WP_072492192.1 | hypothetical protein | - |
| RE424_RS04490 | - | 901973..902320 (+) | 348 | WP_001017815.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| RE424_RS04495 | - | 902332..902715 (+) | 384 | WP_000188639.1 | hypothetical protein | - |
| RE424_RS04500 | - | 902734..903315 (+) | 582 | WP_268652969.1 | phage major tail protein, TP901-1 family | - |
| RE424_RS04505 | - | 903377..903742 (+) | 366 | WP_001100163.1 | tail assembly chaperone | - |
| RE424_RS04510 | - | 903772..904116 (+) | 345 | WP_000105584.1 | hypothetical protein | - |
| RE424_RS04515 | - | 904133..907597 (+) | 3465 | WP_268652968.1 | hypothetical protein | - |
| RE424_RS04520 | - | 907610..908557 (+) | 948 | WP_064420270.1 | phage tail family protein | - |
| RE424_RS04525 | - | 908566..910467 (+) | 1902 | WP_000156406.1 | SGNH/GDSL hydrolase family protein | - |
| RE424_RS04530 | - | 910482..912392 (+) | 1911 | WP_268652967.1 | hypothetical protein | - |
| RE424_RS04535 | - | 912392..914215 (+) | 1824 | WP_138271904.1 | phage baseplate upper protein | - |
| RE424_RS04540 | - | 914215..914592 (+) | 378 | WP_000705896.1 | DUF2977 domain-containing protein | - |
| RE424_RS04545 | - | 914596..914769 (+) | 174 | WP_000782200.1 | XkdX family protein | - |
| RE424_RS04550 | - | 914809..915108 (+) | 300 | WP_000466778.1 | DUF2951 domain-containing protein | - |
| RE424_RS04555 | - | 915245..917143 (+) | 1899 | WP_031924637.1 | glucosaminidase domain-containing protein | - |
| RE424_RS04560 | - | 917156..918394 (+) | 1239 | WP_031924638.1 | BppU family phage baseplate upper protein | - |
| RE424_RS04565 | - | 918399..918794 (+) | 396 | WP_042908139.1 | hypothetical protein | - |
| RE424_RS04570 | - | 918850..919287 (+) | 438 | WP_000354132.1 | phage holin | - |
| RE424_RS04575 | - | 919268..920713 (+) | 1446 | WP_001148131.1 | SH3 domain-containing protein | - |
| RE424_RS04580 | - | 920955..921107 (+) | 153 | WP_001788502.1 | hypothetical protein | - |
| RE424_RS04585 | - | 921178..921288 (+) | 111 | WP_000139423.1 | hypothetical protein | - |
| RE424_RS04590 | - | 921290..921475 (+) | 186 | WP_001286805.1 | hypothetical protein | - |
| RE424_RS04595 | - | 922111..922668 (+) | 558 | WP_000528632.1 | PBECR4 domain-containing protein | - |
| RE424_RS04600 | - | 923144..923281 (+) | 138 | WP_001790198.1 | chorismate mutase | - |
| RE424_RS04605 | - | 923287..923602 (-) | 316 | Protein_890 | hypothetical protein | - |
| RE424_RS04610 | - | 923967..925007 (+) | 1041 | WP_023913587.1 | hemolysin family protein | - |
| RE424_RS04615 | - | 925021..926088 (+) | 1068 | WP_000267248.1 | nitronate monooxygenase family protein | - |
| RE424_RS04620 | - | 926385..926468 (+) | 84 | WP_016170465.1 | hypothetical protein | - |
| RE424_RS04625 | - | 926516..927364 (+) | 849 | WP_000608129.1 | DUF72 domain-containing protein | - |
| RE424_RS04630 | - | 927377..928204 (+) | 828 | WP_000927632.1 | sulfite exporter TauE/SafE family protein | - |
Sequence
Protein
Download Length: 151 a.a. Molecular weight: 17010.54 Da Isoelectric Point: 5.1951
>NTDB_id=878318 RE424_RS04350 WP_268652974.1 888103..888558(+) (ssbA) [Staphylococcus aureus strain 21SAU_AGRO3]
MLNRTVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKDGQRVFVTEVAADSVQFLEPKNSNQQQNDNYQQQNNAYNAPQNRQQNNPFANANSPIEIDDNSLPF
MLNRTVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKDGQRVFVTEVAADSVQFLEPKNSNQQQNDNYQQQNNAYNAPQNRQQNNPFANANSPIEIDDNSLPF
Nucleotide
Download Length: 456 bp
>NTDB_id=878318 RE424_RS04350 WP_268652974.1 888103..888558(+) (ssbA) [Staphylococcus aureus strain 21SAU_AGRO3]
ATGTTAAACAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCAAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGACGGGCAACGTGTGTTTGTTACAGAAGTAGCAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAGTAACCAACAACAAAATGACAATTATCAACAACAGAATAATGCATATAACGCACCACAGAATAGACAACAAAACAATC
CGTTCGCAAACGCTAATAGTCCTATAGAAATCGATGATAATTCGTTACCATTCTAG
ATGTTAAACAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCAAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGACGGGCAACGTGTGTTTGTTACAGAAGTAGCAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAGTAACCAACAACAAAATGACAATTATCAACAACAGAATAATGCATATAACGCACCACAGAATAGACAACAAAACAATC
CGTTCGCAAACGCTAATAGTCCTATAGAAATCGATGATAATTCGTTACCATTCTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
61.047 |
100 |
0.695 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.57 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
70.199 |
0.411 |
| ssb | Neisseria gonorrhoeae MS11 |
34.302 |
100 |
0.391 |
| ssb | Neisseria meningitidis MC58 |
34.302 |
100 |
0.391 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.377 |