Detailed information
Bioinformatically predicted
Overview
| Name | comA | Type | Regulator |
| Locus tag | RA106_RS01410 | Genome accession | NZ_CP132900 |
| Coordinates | 257054..257263 (+) | Length | 69 a.a. |
| NCBI ID | WP_002946147.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain CICC 20372 | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 252054..262263
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RA106_RS01380 (RA106_01385) | - | 252463..253002 (+) | 540 | WP_370869438.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
| RA106_RS01385 (RA106_01390) | - | 253313..253870 (+) | 558 | WP_024704183.1 | ECF transporter S component | - |
| RA106_RS01390 (RA106_01395) | - | 253873..254523 (+) | 651 | WP_011225447.1 | phosphatase PAP2 family protein | - |
| RA106_RS01395 (RA106_01400) | comR | 254718..255617 (+) | 900 | WP_014607953.1 | helix-turn-helix domain-containing protein | Regulator |
| RA106_RS01400 (RA106_01405) | - | 255855..256286 (+) | 432 | Protein_236 | cysteine peptidase family C39 domain-containing protein | - |
| RA106_RS01405 (RA106_01410) | - | 256316..257032 (+) | 717 | Protein_237 | ABC transporter transmembrane domain-containing protein | - |
| RA106_RS01410 (RA106_01415) | comA | 257054..257263 (+) | 210 | WP_002946147.1 | hypothetical protein | Regulator |
| RA106_RS01415 (RA106_01420) | - | 257318..257886 (+) | 569 | Protein_239 | ATP-binding cassette domain-containing protein | - |
| RA106_RS01420 (RA106_01425) | - | 257994..258326 (+) | 333 | WP_024704184.1 | DUF805 domain-containing protein | - |
| RA106_RS01425 (RA106_01430) | - | 258472..258951 (-) | 480 | WP_224107489.1 | DUF4153 domain-containing protein | - |
| RA106_RS01430 (RA106_01435) | - | 259393..259764 (-) | 372 | WP_224107488.1 | hypothetical protein | - |
| RA106_RS01435 (RA106_01440) | - | 260169..260684 (+) | 516 | WP_024704185.1 | AmiS/UreI family transporter | - |
| RA106_RS01440 (RA106_01445) | - | 260709..261011 (+) | 303 | WP_002886558.1 | urease subunit gamma | - |
| RA106_RS01445 (RA106_01450) | - | 261023..261334 (+) | 312 | WP_002886559.1 | urease subunit beta | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 8157.54 Da Isoelectric Point: 9.7339
>NTDB_id=870528 RA106_RS01410 WP_002946147.1 257054..257263(+) (comA) [Streptococcus thermophilus strain CICC 20372]
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
Nucleotide
Download Length: 210 bp
>NTDB_id=870528 RA106_RS01410 WP_002946147.1 257054..257263(+) (comA) [Streptococcus thermophilus strain CICC 20372]
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus gordonii str. Challis substr. CH1 |
54.167 |
100 |
0.565 |
| comA | Streptococcus mitis NCTC 12261 |
52.778 |
100 |
0.551 |
| comA | Streptococcus pneumoniae Rx1 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae D39 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae R6 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae TIGR4 |
51.389 |
100 |
0.536 |
| comA | Streptococcus mitis SK321 |
50 |
100 |
0.522 |
| comA/nlmT | Streptococcus mutans UA159 |
44.286 |
100 |
0.449 |