Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | Q3V89_RS08990 | Genome accession | NZ_CP130526 |
| Coordinates | 1881226..1881696 (-) | Length | 156 a.a. |
| NCBI ID | WP_000934760.1 | Uniprot ID | A0AAN2D761 |
| Organism | Staphylococcus aureus strain SA19-SX | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 1858427..1900304 | 1881226..1881696 | within | 0 |
Gene organization within MGE regions
Location: 1858427..1900304
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| Q3V89_RS08820 | - | 1860116..1861606 (-) | 1491 | WP_001154317.1 | phage tail domain-containing protein | - |
| Q3V89_RS08825 | - | 1861606..1866255 (-) | 4650 | WP_001133523.1 | phage tail tape measure protein | - |
| Q3V89_RS08830 | - | 1866311..1866433 (-) | 123 | WP_000571956.1 | hypothetical protein | - |
| Q3V89_RS08835 | - | 1866493..1866939 (-) | 447 | WP_000442605.1 | hypothetical protein | - |
| Q3V89_RS08840 | - | 1867005..1867958 (-) | 954 | WP_000570648.1 | major tail protein | - |
| Q3V89_RS08845 | - | 1867959..1868339 (-) | 381 | WP_000608371.1 | hypothetical protein | - |
| Q3V89_RS08850 | - | 1868336..1868713 (-) | 378 | WP_303262737.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| Q3V89_RS08855 | - | 1868713..1869048 (-) | 336 | WP_000975314.1 | head-tail adaptor protein | - |
| Q3V89_RS08860 | - | 1869035..1869367 (-) | 333 | WP_001177483.1 | head-tail connector protein | - |
| Q3V89_RS08865 | - | 1869376..1869534 (-) | 159 | WP_001252099.1 | hypothetical protein | - |
| Q3V89_RS08870 | - | 1869570..1870817 (-) | 1248 | WP_000849950.1 | phage major capsid protein | - |
| Q3V89_RS08875 | - | 1870905..1871489 (-) | 585 | WP_000032525.1 | HK97 family phage prohead protease | - |
| Q3V89_RS08880 | - | 1871482..1872732 (-) | 1251 | WP_000511067.1 | phage portal protein | - |
| Q3V89_RS08885 | - | 1872738..1872938 (-) | 201 | WP_000365299.1 | hypothetical protein | - |
| Q3V89_RS08890 | - | 1872952..1874646 (-) | 1695 | WP_303262738.1 | terminase large subunit | - |
| Q3V89_RS08895 | - | 1874649..1875116 (-) | 468 | WP_000919026.1 | phage terminase small subunit P27 family | - |
| Q3V89_RS08900 | - | 1875244..1875588 (-) | 345 | WP_000817289.1 | HNH endonuclease | - |
| Q3V89_RS08905 | - | 1875604..1876056 (-) | 453 | WP_000406191.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| Q3V89_RS08910 | - | 1876171..1876641 (-) | 471 | WP_000282755.1 | hypothetical protein | - |
| Q3V89_RS08915 | - | 1876664..1876864 (-) | 201 | WP_001570807.1 | DUF1514 family protein | - |
| Q3V89_RS08920 | - | 1876864..1876989 (-) | 126 | WP_031783376.1 | transcriptional regulator | - |
| Q3V89_RS08925 | - | 1876982..1877185 (-) | 204 | WP_001072793.1 | hypothetical protein | - |
| Q3V89_RS08930 | - | 1877186..1877377 (-) | 192 | Protein_1760 | hypothetical protein | - |
| Q3V89_RS08935 | - | 1877374..1877580 (-) | 207 | WP_000195826.1 | DUF1381 domain-containing protein | - |
| Q3V89_RS08940 | - | 1877617..1878150 (-) | 534 | WP_025920701.1 | dUTP diphosphatase | - |
| Q3V89_RS08945 | - | 1878165..1878326 (-) | 162 | WP_000889683.1 | hypothetical protein | - |
| Q3V89_RS08950 | - | 1878327..1878608 (-) | 282 | WP_000454994.1 | hypothetical protein | - |
| Q3V89_RS08955 | - | 1878609..1878782 (-) | 174 | WP_000028424.1 | hypothetical protein | - |
| Q3V89_RS08960 | - | 1878772..1879023 (-) | 252 | WP_025174939.1 | DUF1024 family protein | - |
| Q3V89_RS08965 | - | 1879038..1879280 (-) | 243 | WP_000131381.1 | phi PVL orf 51-like protein | - |
| Q3V89_RS08970 | - | 1879284..1879652 (-) | 369 | WP_000101275.1 | SA1788 family PVL leukocidin-associated protein | - |
| Q3V89_RS08975 | - | 1879665..1880069 (-) | 405 | WP_000401978.1 | RusA family crossover junction endodeoxyribonuclease | - |
| Q3V89_RS08980 | - | 1880078..1880296 (-) | 219 | WP_000338527.1 | hypothetical protein | - |
| Q3V89_RS08985 | - | 1880303..1881196 (-) | 894 | WP_000148335.1 | DnaD domain-containing protein | - |
| Q3V89_RS08990 | ssbA | 1881226..1881696 (-) | 471 | WP_000934760.1 | single-stranded DNA-binding protein | Machinery gene |
| Q3V89_RS08995 | - | 1881697..1882314 (-) | 618 | WP_071621397.1 | MBL fold metallo-hydrolase | - |
| Q3V89_RS09000 | - | 1882395..1883315 (-) | 921 | WP_000138475.1 | recombinase RecT | - |
| Q3V89_RS09005 | - | 1883317..1885259 (-) | 1943 | Protein_1775 | AAA family ATPase | - |
| Q3V89_RS09010 | - | 1885268..1885531 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| Q3V89_RS09015 | - | 1885540..1885800 (-) | 261 | WP_000291488.1 | DUF1108 family protein | - |
| Q3V89_RS09020 | - | 1885893..1886054 (-) | 162 | WP_000066020.1 | DUF1270 domain-containing protein | - |
| Q3V89_RS09025 | - | 1886051..1886371 (-) | 321 | WP_001120197.1 | DUF771 domain-containing protein | - |
| Q3V89_RS09030 | - | 1886430..1887059 (+) | 630 | Protein_1780 | hypothetical protein | - |
| Q3V89_RS09035 | - | 1887074..1887214 (-) | 141 | WP_000939496.1 | hypothetical protein | - |
| Q3V89_RS09040 | - | 1887245..1887442 (-) | 198 | WP_001148861.1 | hypothetical protein | - |
| Q3V89_RS09045 | - | 1887458..1888207 (-) | 750 | WP_001148337.1 | phage antirepressor KilAC domain-containing protein | - |
| Q3V89_RS09050 | - | 1888264..1888803 (+) | 540 | WP_000351243.1 | hypothetical protein | - |
| Q3V89_RS09055 | - | 1888827..1889087 (-) | 261 | WP_000435341.1 | transcriptional regulator | - |
| Q3V89_RS09060 | - | 1889105..1889329 (-) | 225 | WP_000338185.1 | DUF739 family protein | - |
| Q3V89_RS09065 | - | 1889488..1890258 (+) | 771 | WP_031783378.1 | S24 family peptidase | - |
| Q3V89_RS09070 | - | 1890458..1890640 (+) | 183 | WP_000705240.1 | hypothetical protein | - |
| Q3V89_RS09075 | - | 1890676..1890822 (+) | 147 | WP_001013104.1 | hypothetical protein | - |
| Q3V89_RS09080 | - | 1890819..1891433 (-) | 615 | WP_000191459.1 | hypothetical protein | - |
| Q3V89_RS09085 | - | 1891541..1892578 (+) | 1038 | WP_000857176.1 | site-specific integrase | - |
| Q3V89_RS09090 | - | 1892741..1894099 (-) | 1359 | WP_031883303.1 | FtsK/SpoIIIE domain-containing protein | - |
| Q3V89_RS09095 | - | 1894153..1896648 (-) | 2496 | WP_001049264.1 | ATP-binding protein | - |
| Q3V89_RS09100 | - | 1896683..1897066 (-) | 384 | WP_000358144.1 | TcpE family conjugal transfer membrane protein | - |
| Q3V89_RS09105 | - | 1897078..1897338 (-) | 261 | WP_000015644.1 | TcpD family membrane protein | - |
| Q3V89_RS09110 | - | 1897343..1898398 (-) | 1056 | WP_000692005.1 | conjugal transfer protein | - |
| Q3V89_RS09115 | - | 1898459..1899550 (-) | 1092 | WP_000172943.1 | replication initiation factor domain-containing protein | - |
| Q3V89_RS09120 | - | 1899725..1900027 (-) | 303 | WP_000386891.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17641.52 Da Isoelectric Point: 5.2672
>NTDB_id=859553 Q3V89_RS08990 WP_000934760.1 1881226..1881696(-) (ssbA) [Staphylococcus aureus strain SA19-SX]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=859553 Q3V89_RS08990 WP_000934760.1 1881226..1881696(-) (ssbA) [Staphylococcus aureus strain SA19-SX]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTGA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.768 |
100 |
0.372 |
| ssb | Neisseria meningitidis MC58 |
32.948 |
100 |
0.365 |
| ssb | Neisseria gonorrhoeae MS11 |
32.948 |
100 |
0.365 |