Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGD   Type   Machinery gene
Locus tag   QYM42_RS11555 Genome accession   NZ_CP129526
Coordinates   2316643..2317059 (-) Length   138 a.a.
NCBI ID   WP_032941843.1    Uniprot ID   -
Organism   Lactococcus lactis strain ZZ-2     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2315124..2360425 2316643..2317059 within 0


Gene organization within MGE regions


Location: 2315124..2360425
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QYM42_RS11535 (QYM42_11535) - 2315124..2315561 (-) 438 WP_201248645.1 zinc-dependent MarR family transcriptional regulator -
  QYM42_RS11540 (QYM42_11540) comGG 2315643..2315927 (-) 285 WP_025017139.1 competence type IV pilus minor pilin ComGG Machinery gene
  QYM42_RS11545 (QYM42_11545) comGF 2315966..2316412 (-) 447 WP_029344525.1 competence type IV pilus minor pilin ComGF Machinery gene
  QYM42_RS11550 (QYM42_11550) comGE 2316375..2316671 (-) 297 WP_010906316.1 competence type IV pilus minor pilin ComGE Machinery gene
  QYM42_RS11555 (QYM42_11555) comGD 2316643..2317059 (-) 417 WP_032941843.1 competence type IV pilus minor pilin ComGD Machinery gene
  QYM42_RS11560 (QYM42_11560) comGC 2317034..2317303 (-) 270 WP_021721869.1 competence type IV pilus major pilin ComGC Machinery gene
  QYM42_RS11570 (QYM42_11570) - 2317797..2317997 (-) 201 WP_058203534.1 cold-shock protein -
  QYM42_RS11575 (QYM42_11575) - 2319243..2319686 (-) 444 WP_301675256.1 type II toxin-antitoxin system PemK/MazF family toxin -
  QYM42_RS11580 (QYM42_11580) - 2319713..2320525 (-) 813 WP_301675257.1 DUF3800 domain-containing protein -
  QYM42_RS11585 (QYM42_11585) - 2320638..2320814 (-) 177 WP_301675258.1 hypothetical protein -
  QYM42_RS11590 (QYM42_11590) - 2320893..2321171 (-) 279 WP_301675259.1 hypothetical protein -
  QYM42_RS11595 (QYM42_11595) - 2321253..2322032 (-) 780 WP_301675260.1 peptidoglycan amidohydrolase family protein -
  QYM42_RS11600 (QYM42_11600) - 2322032..2322307 (-) 276 WP_301675261.1 holin -
  QYM42_RS11605 (QYM42_11605) - 2322291..2322599 (-) 309 WP_301675262.1 hypothetical protein -
  QYM42_RS11610 (QYM42_11610) - 2322645..2323634 (-) 990 WP_301675263.1 hypothetical protein -
  QYM42_RS11615 (QYM42_11615) - 2323634..2323771 (-) 138 WP_201261391.1 hypothetical protein -
  QYM42_RS11620 (QYM42_11620) - 2323768..2326305 (-) 2538 WP_301675264.1 gp58-like family protein -
  QYM42_RS11625 (QYM42_11625) - 2326317..2326682 (-) 366 WP_038600483.1 DUF6711 family protein -
  QYM42_RS11630 (QYM42_11630) - 2326694..2331718 (-) 5025 WP_301675265.1 phage tail protein -
  QYM42_RS11635 (QYM42_11635) - 2331751..2332122 (-) 372 WP_058211308.1 hypothetical protein -
  QYM42_RS11640 (QYM42_11640) - 2332146..2332556 (-) 411 WP_021722204.1 DUF6096 family protein -
  QYM42_RS11645 (QYM42_11645) - 2332632..2332871 (-) 240 WP_301675266.1 Ig-like domain-containing protein -
  QYM42_RS11650 (QYM42_11650) - 2332897..2333316 (-) 420 WP_058211307.1 phage tail tube protein -
  QYM42_RS11655 (QYM42_11655) - 2333329..2333691 (-) 363 WP_251899934.1 hypothetical protein -
  QYM42_RS11660 (QYM42_11660) - 2333691..2334239 (-) 549 WP_301675267.1 HK97 gp10 family phage protein -
  QYM42_RS11665 (QYM42_11665) - 2334223..2334576 (-) 354 WP_081213603.1 hypothetical protein -
  QYM42_RS11670 (QYM42_11670) - 2334557..2334889 (-) 333 WP_282798579.1 phage head-tail connector protein -
  QYM42_RS11675 (QYM42_11675) - 2334909..2336030 (-) 1122 WP_282798578.1 Ig-like domain-containing protein -
  QYM42_RS11680 (QYM42_11680) - 2336042..2336668 (-) 627 WP_301675385.1 DUF4355 domain-containing protein -
  QYM42_RS11685 (QYM42_11685) - 2336833..2337939 (-) 1107 WP_301675268.1 minor capsid protein -
  QYM42_RS11690 (QYM42_11690) - 2337945..2338232 (-) 288 WP_015426800.1 ribosomal-processing cysteine protease Prp -
  QYM42_RS11695 (QYM42_11695) - 2338229..2338468 (-) 240 WP_301675269.1 hypothetical protein -
  QYM42_RS11700 (QYM42_11700) - 2338510..2338674 (-) 165 WP_167595927.1 hypothetical protein -
  QYM42_RS11705 (QYM42_11705) - 2338631..2340139 (-) 1509 WP_301675270.1 phage portal protein -
  QYM42_RS11710 (QYM42_11710) - 2340149..2341432 (-) 1284 WP_251899943.1 PBSX family phage terminase large subunit -
  QYM42_RS11715 (QYM42_11715) - 2341425..2341904 (-) 480 WP_257140897.1 terminase small subunit -
  QYM42_RS11725 (QYM42_11725) - 2342182..2342607 (-) 426 WP_301675271.1 RinA family protein -
  QYM42_RS11730 (QYM42_11730) - 2342685..2342894 (-) 210 WP_301675272.1 hypothetical protein -
  QYM42_RS11735 (QYM42_11735) - 2343270..2343479 (-) 210 WP_301675273.1 DUF1660 domain-containing protein -
  QYM42_RS11740 (QYM42_11740) - 2343488..2343715 (-) 228 WP_301675274.1 hypothetical protein -
  QYM42_RS11745 (QYM42_11745) dcm 2343762..2345024 (-) 1263 WP_301675275.1 DNA (cytosine-5-)-methyltransferase -
  QYM42_RS11750 (QYM42_11750) - 2345021..2345410 (-) 390 WP_301675276.1 hypothetical protein -
  QYM42_RS11755 (QYM42_11755) - 2345403..2345654 (-) 252 WP_301675277.1 6-O-methylguanine DNA methyltransferase -
  QYM42_RS11760 (QYM42_11760) - 2345647..2346162 (-) 516 WP_301675278.1 hypothetical protein -
  QYM42_RS11765 (QYM42_11765) - 2346319..2346471 (-) 153 WP_301675279.1 DUF1737 domain-containing protein -
  QYM42_RS11770 (QYM42_11770) - 2346468..2347076 (-) 609 WP_301675280.1 DUF1642 domain-containing protein -
  QYM42_RS11775 (QYM42_11775) - 2347073..2347360 (-) 288 WP_301675281.1 hypothetical protein -
  QYM42_RS11780 (QYM42_11780) - 2347371..2347601 (-) 231 WP_301675282.1 hypothetical protein -
  QYM42_RS11785 (QYM42_11785) - 2347598..2347804 (-) 207 WP_301675283.1 hypothetical protein -
  QYM42_RS11790 (QYM42_11790) - 2347826..2348014 (-) 189 WP_301675284.1 hypothetical protein -
  QYM42_RS11795 (QYM42_11795) - 2348011..2348436 (-) 426 WP_301675285.1 hypothetical protein -
  QYM42_RS11800 (QYM42_11800) - 2348439..2348639 (-) 201 WP_301675286.1 hypothetical protein -
  QYM42_RS11805 (QYM42_11805) - 2348690..2349061 (+) 372 WP_301675287.1 hypothetical protein -
  QYM42_RS11810 (QYM42_11810) - 2348991..2349200 (-) 210 WP_270249512.1 hypothetical protein -
  QYM42_RS11815 (QYM42_11815) - 2349216..2349458 (-) 243 WP_301675288.1 L-rhamnose isomerase -
  QYM42_RS11820 (QYM42_11820) - 2349451..2350368 (-) 918 WP_301675289.1 phage replisome organizer N-terminal domain-containing protein -
  QYM42_RS11825 (QYM42_11825) - 2350634..2351560 (-) 927 WP_301675290.1 RecT family recombinase -
  QYM42_RS11830 (QYM42_11830) - 2351557..2352390 (-) 834 WP_301675291.1 hypothetical protein -
  QYM42_RS11835 (QYM42_11835) - 2352513..2352728 (-) 216 WP_010905687.1 DUF1408 domain-containing protein -
  QYM42_RS11840 (QYM42_11840) - 2352728..2352928 (-) 201 WP_058205859.1 helix-turn-helix transcriptional regulator -
  QYM42_RS11845 (QYM42_11845) - 2353077..2353277 (+) 201 WP_103054998.1 hypothetical protein -
  QYM42_RS11850 (QYM42_11850) - 2353267..2353398 (-) 132 WP_272938640.1 hypothetical protein -
  QYM42_RS11855 (QYM42_11855) - 2353744..2354547 (-) 804 WP_301675292.1 phage antirepressor KilAC domain-containing protein -
  QYM42_RS11860 (QYM42_11860) - 2354559..2354807 (-) 249 WP_251899967.1 helix-turn-helix transcriptional regulator -
  QYM42_RS11865 (QYM42_11865) - 2354988..2355647 (+) 660 WP_301675293.1 hypothetical protein -
  QYM42_RS11870 (QYM42_11870) - 2355910..2356464 (+) 555 WP_251899969.1 helix-turn-helix domain-containing protein -
  QYM42_RS11875 (QYM42_11875) - 2356475..2357062 (+) 588 WP_251899970.1 hypothetical protein -
  QYM42_RS11880 (QYM42_11880) - 2357124..2357675 (+) 552 WP_301675294.1 hypothetical protein -
  QYM42_RS11885 (QYM42_11885) - 2357798..2359255 (+) 1458 WP_301675295.1 recombinase family protein -
  QYM42_RS11890 (QYM42_11890) - 2359252..2359392 (-) 141 WP_228248618.1 hypothetical protein -
  QYM42_RS11895 (QYM42_11895) comGB 2359406..2360425 (-) 1020 WP_047206974.1 competence type IV pilus assembly protein ComGB Machinery gene

Sequence

Protein


Download         Length: 138 a.a.        Molecular weight: 15916.68 Da        Isoelectric Point: 7.9840

>NTDB_id=853954 QYM42_RS11555 WP_032941843.1 2316643..2317059(-) (comGD) [Lactococcus lactis strain ZZ-2]
MKNEILMTRAFTLLESLLVLLIISFITTLFSLEIIQTVHLFKGELFVLQFENFYKRSQEDAALLQKSESLVAKNQELICE
DRSITIPKEVAVKDFTVKFDDKGENSSLQKLTISLPYEKKFITYQLEIGSGKFKKKIS

Nucleotide


Download         Length: 417 bp        

>NTDB_id=853954 QYM42_RS11555 WP_032941843.1 2316643..2317059(-) (comGD) [Lactococcus lactis strain ZZ-2]
ATGAAGAACGAAATTTTAATGACTAGAGCATTTACTTTACTAGAGTCTCTTCTAGTTTTGTTGATTATTTCTTTTATCAC
AACTCTTTTTTCTTTAGAAATAATACAAACAGTCCATCTTTTTAAGGGAGAATTGTTTGTTCTCCAGTTTGAAAATTTCT
ATAAAAGGAGTCAAGAAGATGCTGCACTGCTTCAAAAATCTGAAAGTTTAGTTGCTAAAAATCAAGAATTAATCTGTGAA
GATAGAAGTATCACAATTCCAAAGGAGGTAGCAGTTAAAGATTTTACAGTTAAATTTGATGATAAGGGAGAGAATTCTAG
CTTACAAAAACTCACAATTTCTTTACCTTACGAAAAAAAGTTCATCACTTATCAATTGGAGATAGGCAGTGGAAAATTTA
AAAAGAAAATCAGTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Lactococcus lactis subsp. cremoris KW2

67.391

100

0.674
  comYD Streptococcus gordonii str. Challis substr. CH1

39.695

94.928

0.377
  comYD Streptococcus mutans UA140

39.844

92.754

0.37
  comYD Streptococcus mutans UA159

39.844

92.754

0.37