Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | QM342_RS09805 | Genome accession | NZ_CP125895 |
| Coordinates | 1997784..1998254 (-) | Length | 156 a.a. |
| NCBI ID | WP_000934760.1 | Uniprot ID | A0AAN2D761 |
| Organism | Staphylococcus aureus strain CHAL5 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1968441..2021065 | 1997784..1998254 | within | 0 |
Gene organization within MGE regions
Location: 1968441..2021065
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QM342_RS09590 (QM342_09590) | scn | 1968441..1968791 (-) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| QM342_RS09595 (QM342_09595) | - | 1969474..1969923 (+) | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| QM342_RS09600 (QM342_09600) | - | 1970018..1970352 (-) | 335 | Protein_1855 | SH3 domain-containing protein | - |
| QM342_RS09605 (QM342_09605) | sak | 1971002..1971493 (-) | 492 | WP_000919350.1 | staphylokinase | - |
| QM342_RS09610 (QM342_09610) | - | 1971684..1972439 (-) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| QM342_RS09615 (QM342_09615) | - | 1972451..1972705 (-) | 255 | WP_000611512.1 | phage holin | - |
| QM342_RS09620 (QM342_09620) | - | 1972757..1972864 (+) | 108 | WP_001791821.1 | hypothetical protein | - |
| QM342_RS09625 (QM342_09625) | pepG1 | 1972917..1973051 (-) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| QM342_RS09630 (QM342_09630) | - | 1973243..1973539 (-) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| QM342_RS09635 (QM342_09635) | - | 1973597..1973884 (-) | 288 | WP_001040261.1 | hypothetical protein | - |
| QM342_RS09640 (QM342_09640) | - | 1973931..1974083 (-) | 153 | WP_001153681.1 | hypothetical protein | - |
| QM342_RS09645 (QM342_09645) | - | 1974073..1977858 (-) | 3786 | WP_000582165.1 | phage tail spike protein | - |
| QM342_RS09650 (QM342_09650) | - | 1977874..1979358 (-) | 1485 | WP_000567408.1 | phage tail domain-containing protein | - |
| QM342_RS09655 (QM342_09655) | - | 1979355..1983899 (-) | 4545 | WP_283482818.1 | phage tail tape measure protein | - |
| QM342_RS09660 (QM342_09660) | - | 1983956..1984093 (-) | 138 | WP_001549167.1 | hypothetical protein | - |
| QM342_RS09665 (QM342_09665) | - | 1984144..1984494 (-) | 351 | WP_001096355.1 | hypothetical protein | - |
| QM342_RS09670 (QM342_09670) | - | 1984545..1984775 (-) | 231 | Protein_1869 | Ig-like domain-containing protein | - |
| QM342_RS09675 (QM342_09675) | - | 1984811..1985455 (-) | 645 | WP_000268736.1 | major tail protein | - |
| QM342_RS09680 (QM342_09680) | - | 1985456..1985863 (-) | 408 | WP_000565498.1 | hypothetical protein | - |
| QM342_RS09685 (QM342_09685) | - | 1985860..1986264 (-) | 405 | WP_000114341.1 | HK97 gp10 family phage protein | - |
| QM342_RS09690 (QM342_09690) | - | 1986261..1986623 (-) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| QM342_RS09695 (QM342_09695) | - | 1986607..1986891 (-) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| QM342_RS09700 (QM342_09700) | - | 1986881..1987165 (-) | 285 | WP_000238240.1 | hypothetical protein | - |
| QM342_RS09705 (QM342_09705) | - | 1987185..1988330 (-) | 1146 | WP_000154552.1 | phage major capsid protein | - |
| QM342_RS09710 (QM342_09710) | - | 1988354..1989091 (-) | 738 | WP_000642728.1 | head maturation protease, ClpP-related | - |
| QM342_RS09715 (QM342_09715) | - | 1989075..1990262 (-) | 1188 | WP_000025266.1 | phage portal protein | - |
| QM342_RS09720 (QM342_09720) | - | 1990278..1991939 (-) | 1662 | WP_000625096.1 | terminase large subunit | - |
| QM342_RS09725 (QM342_09725) | - | 1991936..1992280 (-) | 345 | WP_000402904.1 | hypothetical protein | - |
| QM342_RS09730 (QM342_09730) | - | 1992410..1992709 (-) | 300 | WP_000988336.1 | HNH endonuclease | - |
| QM342_RS09735 (QM342_09735) | - | 1992941..1993357 (-) | 417 | WP_000590122.1 | hypothetical protein | - |
| QM342_RS09740 (QM342_09740) | - | 1993385..1993585 (-) | 201 | WP_000265043.1 | DUF1514 family protein | - |
| QM342_RS09745 (QM342_09745) | - | 1993585..1993734 (-) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| QM342_RS09750 (QM342_09750) | - | 1993731..1994117 (-) | 387 | WP_000592207.1 | hypothetical protein | - |
| QM342_RS09755 (QM342_09755) | - | 1994114..1994320 (-) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| QM342_RS09760 (QM342_09760) | - | 1994317..1994562 (-) | 246 | WP_001282074.1 | hypothetical protein | - |
| QM342_RS09765 (QM342_09765) | - | 1994599..1995135 (-) | 537 | WP_001066447.1 | dUTP diphosphatase | - |
| QM342_RS09770 (QM342_09770) | - | 1995128..1995298 (-) | 171 | WP_000714403.1 | hypothetical protein | - |
| QM342_RS09775 (QM342_09775) | - | 1995285..1995539 (-) | 255 | WP_031897140.1 | DUF1024 family protein | - |
| QM342_RS09780 (QM342_09780) | - | 1995554..1995796 (-) | 243 | WP_000131381.1 | phi PVL orf 51-like protein | - |
| QM342_RS09785 (QM342_09785) | - | 1995800..1996168 (-) | 369 | WP_000101270.1 | SA1788 family PVL leukocidin-associated protein | - |
| QM342_RS09790 (QM342_09790) | - | 1996181..1996636 (-) | 456 | WP_000401965.1 | RusA family crossover junction endodeoxyribonuclease | - |
| QM342_RS09795 (QM342_09795) | - | 1996645..1996863 (-) | 219 | WP_000338528.1 | hypothetical protein | - |
| QM342_RS09800 (QM342_09800) | - | 1996870..1997754 (-) | 885 | WP_031833239.1 | DnaD domain protein | - |
| QM342_RS09805 (QM342_09805) | ssbA | 1997784..1998254 (-) | 471 | WP_000934760.1 | single-stranded DNA-binding protein | Machinery gene |
| QM342_RS09810 (QM342_09810) | - | 1998255..1998872 (-) | 618 | WP_071621397.1 | MBL fold metallo-hydrolase | - |
| QM342_RS09815 (QM342_09815) | - | 1998953..1999873 (-) | 921 | WP_000138475.1 | recombinase RecT | - |
| QM342_RS09820 (QM342_09820) | - | 1999875..2001818 (-) | 1944 | WP_234738471.1 | AAA family ATPase | - |
| QM342_RS09825 (QM342_09825) | - | 2001827..2002090 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| QM342_RS09830 (QM342_09830) | - | 2002099..2002359 (-) | 261 | WP_000291510.1 | DUF1108 family protein | - |
| QM342_RS09835 (QM342_09835) | - | 2002364..2002666 (-) | 303 | WP_000165371.1 | DUF2482 family protein | - |
| QM342_RS09840 (QM342_09840) | - | 2002761..2002922 (-) | 162 | WP_000048129.1 | DUF1270 family protein | - |
| QM342_RS09845 (QM342_09845) | - | 2002919..2003242 (-) | 324 | WP_001120201.1 | DUF771 domain-containing protein | - |
| QM342_RS09850 (QM342_09850) | - | 2003297..2003677 (+) | 381 | WP_061819783.1 | DUF2513 domain-containing protein | - |
| QM342_RS09855 (QM342_09855) | - | 2003664..2003861 (-) | 198 | WP_001148862.1 | hypothetical protein | - |
| QM342_RS09860 (QM342_09860) | - | 2003877..2004629 (-) | 753 | WP_001148647.1 | phage antirepressor KilAC domain-containing protein | - |
| QM342_RS09865 (QM342_09865) | - | 2004652..2004879 (-) | 228 | WP_000192116.1 | helix-turn-helix transcriptional regulator | - |
| QM342_RS09870 (QM342_09870) | - | 2005033..2005665 (+) | 633 | WP_000901359.1 | XRE family transcriptional regulator | - |
| QM342_RS09875 (QM342_09875) | - | 2005846..2006544 (+) | 699 | WP_000837517.1 | potassium channel family protein | - |
| QM342_RS09880 (QM342_09880) | - | 2006700..2006882 (+) | 183 | WP_000694772.1 | hypothetical protein | - |
| QM342_RS09885 (QM342_09885) | - | 2007018..2008676 (+) | 1659 | WP_001286807.1 | DpnII family type II restriction endonuclease | - |
| QM342_RS09890 (QM342_09890) | - | 2008732..2009769 (+) | 1038 | WP_000857188.1 | site-specific integrase | - |
| QM342_RS09895 (QM342_09895) | sph | 2009820..2010650 (+) | 831 | Protein_1914 | sphingomyelin phosphodiesterase | - |
| QM342_RS09900 (QM342_09900) | lukG | 2011151..2012167 (-) | 1017 | WP_000595401.1 | bi-component leukocidin LukGH subunit G | - |
| QM342_RS09905 (QM342_09905) | lukH | 2012189..2013241 (-) | 1053 | WP_000791404.1 | bi-component leukocidin LukGH subunit H | - |
| QM342_RS09910 (QM342_09910) | - | 2013677..2014900 (+) | 1224 | WP_283482888.1 | ArgE/DapE family deacylase | - |
| QM342_RS09915 (QM342_09915) | - | 2015273..2016117 (-) | 845 | Protein_1918 | class I SAM-dependent methyltransferase | - |
| QM342_RS09920 (QM342_09920) | - | 2016179..2017090 (-) | 912 | WP_000825510.1 | iron-hydroxamate ABC transporter substrate-binding protein | - |
| QM342_RS09925 (QM342_09925) | - | 2017251..2018558 (+) | 1308 | WP_001045085.1 | TrkH family potassium uptake protein | - |
| QM342_RS09930 (QM342_09930) | groL | 2019089..2020705 (-) | 1617 | WP_000240645.1 | chaperonin GroEL | - |
| QM342_RS09935 (QM342_09935) | groES | 2020781..2021065 (-) | 285 | WP_000917289.1 | co-chaperone GroES | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17641.52 Da Isoelectric Point: 5.2672
>NTDB_id=833447 QM342_RS09805 WP_000934760.1 1997784..1998254(-) (ssbA) [Staphylococcus aureus strain CHAL5]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=833447 QM342_RS09805 WP_000934760.1 1997784..1998254(-) (ssbA) [Staphylococcus aureus strain CHAL5]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTGA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.768 |
100 |
0.372 |
| ssb | Neisseria meningitidis MC58 |
32.948 |
100 |
0.365 |
| ssb | Neisseria gonorrhoeae MS11 |
32.948 |
100 |
0.365 |