Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   LLUL033_RS11720 Genome accession   NZ_CP122980
Coordinates   2301686..2301985 (-) Length   99 a.a.
NCBI ID   WP_011836042.1    Uniprot ID   A2RNS3
Organism   Lactococcus cremoris strain UL033     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 2297145..2311108 2301686..2301985 within 0


Gene organization within MGE regions


Location: 2297145..2311108
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LLUL033_RS11700 (LLUL033_11705) - 2298611..2299420 (-) 810 WP_011677177.1 metal ABC transporter permease -
  LLUL033_RS11705 (LLUL033_11710) - 2299413..2300150 (-) 738 WP_332370438.1 metal ABC transporter ATP-binding protein -
  LLUL033_RS11710 (LLUL033_11715) - 2300329..2301171 (-) 843 WP_011836040.1 metal ABC transporter solute-binding protein, Zn/Mn family -
  LLUL033_RS11715 (LLUL033_11720) - 2301168..2301605 (-) 438 WP_011836041.1 zinc-dependent MarR family transcriptional regulator -
  LLUL033_RS11720 (LLUL033_11725) comGG 2301686..2301985 (-) 300 WP_011836042.1 competence type IV pilus minor pilin ComGG Machinery gene
  LLUL033_RS11725 (LLUL033_11730) comGF 2302009..2302434 (-) 426 WP_014735174.1 competence type IV pilus minor pilin ComGF Machinery gene
  LLUL033_RS11730 (LLUL033_11735) comGE 2302418..2302714 (-) 297 WP_014735175.1 competence type IV pilus minor pilin ComGE Machinery gene
  LLUL033_RS11735 (LLUL033_11740) comGD 2302686..2303117 (-) 432 WP_260368600.1 competence type IV pilus minor pilin ComGD Machinery gene
  LLUL033_RS11740 (LLUL033_11745) comGC 2303077..2303454 (-) 378 WP_375794176.1 competence type IV pilus major pilin ComGC Machinery gene
  LLUL033_RS11745 (LLUL033_11750) comGB 2303472..2304497 (-) 1026 WP_042211510.1 competence type IV pilus assembly protein ComGB Machinery gene
  LLUL033_RS11750 (LLUL033_11755) comGA 2304397..2305377 (-) 981 WP_011836048.1 competence type IV pilus ATPase ComGA Machinery gene
  LLUL033_RS11755 (LLUL033_11760) - 2305491..2309273 (-) 3783 Protein_2290 PolC-type DNA polymerase III -
  LLUL033_RS11760 - 2309805..2310398 (-) 594 Protein_2291 PolC-type DNA polymerase III N-terminal domain-containing protein -
  LLUL033_RS11765 (LLUL033_11765) - 2310572..2311108 (-) 537 WP_011836050.1 hypothetical protein -

Sequence

Protein


Download         Length: 99 a.a.        Molecular weight: 11211.23 Da        Isoelectric Point: 10.0446

>NTDB_id=817692 LLUL033_RS11720 WP_011836042.1 2301686..2301985(-) (comGG) [Lactococcus cremoris strain UL033]
MVLLLIFSLFLQFYLQKQVLTAQQLKIEKERLTAELMVSLALKKDLKTSGQLNFDCGNLTYKLLTDLSAGSTSGGQTVSN
KTYCFDVRLKDGRIFQIKK

Nucleotide


Download         Length: 300 bp        

>NTDB_id=817692 LLUL033_RS11720 WP_011836042.1 2301686..2301985(-) (comGG) [Lactococcus cremoris strain UL033]
TTGGTTTTACTGCTAATTTTTTCTTTATTTCTACAGTTTTATTTGCAAAAACAGGTGCTTACAGCTCAGCAATTGAAAAT
AGAAAAGGAGCGACTGACAGCCGAATTAATGGTTTCATTGGCTCTTAAAAAGGATTTGAAAACGAGTGGTCAACTTAATT
TTGATTGTGGAAATTTAACTTATAAATTACTGACAGATCTGTCAGCTGGTTCAACTAGCGGTGGTCAAACTGTTAGTAAT
AAAACTTATTGTTTTGATGTTCGGCTTAAGGATGGAAGGATTTTTCAAATAAAAAAGTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A2RNS3

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

98.99

100

0.99