Detailed information
Bioinformatically predicted
Overview
| Name | dprA | Type | Machinery gene |
| Locus tag | P7Y79_RS04660 | Genome accession | NZ_CP121207 |
| Coordinates | 962089..962931 (+) | Length | 280 a.a. |
| NCBI ID | WP_157629020.1 | Uniprot ID | - |
| Organism | Streptococcus ruminicola strain CNU_77-47 | ||
| Function | ssDNA binding; loading RecA onto ssDNA (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 918013..1014043 | 962089..962931 | within | 0 |
Gene organization within MGE regions
Location: 918013..1014043
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P7Y79_RS04435 (P7Y79_04435) | - | 919237..920226 (-) | 990 | WP_039696869.1 | L-lactate dehydrogenase | - |
| P7Y79_RS04440 (P7Y79_04440) | gyrA | 920577..923030 (+) | 2454 | WP_039696870.1 | DNA gyrase subunit A | - |
| P7Y79_RS04445 (P7Y79_04445) | - | 923035..923775 (+) | 741 | WP_158913870.1 | class A sortase | - |
| P7Y79_RS04450 (P7Y79_04450) | - | 923842..924255 (+) | 414 | WP_278007821.1 | VOC family protein | - |
| P7Y79_RS04455 (P7Y79_04455) | - | 924340..925311 (+) | 972 | WP_278007822.1 | DUF1002 domain-containing protein | - |
| P7Y79_RS04460 (P7Y79_04460) | - | 925433..926332 (+) | 900 | WP_157629038.1 | TDT family transporter | - |
| P7Y79_RS04465 (P7Y79_04465) | - | 926527..927786 (+) | 1260 | WP_074625720.1 | NRAMP family divalent metal transporter | - |
| P7Y79_RS04470 (P7Y79_04470) | - | 927981..929696 (-) | 1716 | WP_278007823.1 | phospho-sugar mutase | - |
| P7Y79_RS04475 (P7Y79_04475) | - | 929914..930486 (-) | 573 | WP_014334774.1 | ECF transporter S component | - |
| P7Y79_RS04480 (P7Y79_04480) | coaC | 930575..931114 (-) | 540 | WP_278007824.1 | phosphopantothenoylcysteine decarboxylase | - |
| P7Y79_RS04485 (P7Y79_04485) | - | 931107..931793 (-) | 687 | WP_157629035.1 | phosphopantothenate--cysteine ligase | - |
| P7Y79_RS04490 (P7Y79_04490) | - | 932161..933831 (+) | 1671 | WP_157629034.1 | formate--tetrahydrofolate ligase | - |
| P7Y79_RS04495 (P7Y79_04495) | cls | 933946..935535 (+) | 1590 | WP_157629033.1 | cardiolipin synthase | - |
| P7Y79_RS04500 (P7Y79_04500) | - | 935878..936954 (+) | 1077 | WP_278007825.1 | aspartate-semialdehyde dehydrogenase | - |
| P7Y79_RS04505 (P7Y79_04505) | dapA | 937042..937977 (+) | 936 | WP_014334769.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| P7Y79_RS04510 (P7Y79_04510) | - | 938032..939297 (-) | 1266 | WP_278007826.1 | PLP-dependent aminotransferase family protein | - |
| P7Y79_RS04515 (P7Y79_04515) | - | 939433..940293 (+) | 861 | WP_278007827.1 | pyridoxamine kinase | - |
| P7Y79_RS04520 (P7Y79_04520) | - | 940290..940847 (+) | 558 | WP_278007828.1 | ECF transporter S component | - |
| P7Y79_RS04525 (P7Y79_04525) | - | 941007..942545 (+) | 1539 | WP_024344076.1 | ABC-F family ATP-binding cassette domain-containing protein | - |
| P7Y79_RS04530 (P7Y79_04530) | - | 942875..943198 (+) | 324 | WP_074628674.1 | hypothetical protein | - |
| P7Y79_RS04535 (P7Y79_04535) | - | 943406..943813 (-) | 408 | WP_278007829.1 | DUF4231 domain-containing protein | - |
| P7Y79_RS04540 (P7Y79_04540) | - | 944264..944437 (+) | 174 | WP_278007830.1 | hypothetical protein | - |
| P7Y79_RS04545 (P7Y79_04545) | - | 944434..945225 (+) | 792 | Protein_900 | replication initiator protein A | - |
| P7Y79_RS04550 (P7Y79_04550) | - | 945238..946496 (-) | 1259 | Protein_901 | Y-family DNA polymerase | - |
| P7Y79_RS04555 (P7Y79_04555) | - | 946501..946635 (-) | 135 | WP_014294857.1 | hypothetical protein | - |
| P7Y79_RS04560 (P7Y79_04560) | - | 946638..947208 (-) | 571 | Protein_903 | XRE family transcriptional regulator | - |
| P7Y79_RS04565 (P7Y79_04565) | - | 947437..947688 (+) | 252 | WP_278007124.1 | hypothetical protein | - |
| P7Y79_RS04570 (P7Y79_04570) | - | 947847..948149 (+) | 303 | WP_166044172.1 | hypothetical protein | - |
| P7Y79_RS04575 (P7Y79_04575) | - | 948215..949495 (+) | 1281 | WP_278007125.1 | protein kinase | - |
| P7Y79_RS04580 (P7Y79_04580) | - | 949504..950427 (+) | 924 | WP_278007126.1 | ABC transporter ATP-binding protein | - |
| P7Y79_RS04585 (P7Y79_04585) | - | 950420..951220 (+) | 801 | WP_278007127.1 | ABC transporter permease | - |
| P7Y79_RS04590 (P7Y79_04590) | - | 951649..952008 (+) | 360 | WP_278007128.1 | SAG1252 family conjugative relaxosome accessory protein | - |
| P7Y79_RS04595 (P7Y79_04595) | - | 952018..952387 (+) | 370 | Protein_910 | MobC family plasmid mobilization relaxosome protein | - |
| P7Y79_RS04600 (P7Y79_04600) | - | 952374..953941 (+) | 1568 | Protein_911 | relaxase/mobilization nuclease domain-containing protein | - |
| P7Y79_RS04605 (P7Y79_04605) | - | 954108..954980 (+) | 873 | WP_278007129.1 | helix-turn-helix transcriptional regulator | - |
| P7Y79_RS04610 (P7Y79_04610) | tnpA | 955152..955399 (+) | 248 | Protein_913 | IS200/IS605 family transposase | - |
| P7Y79_RS04615 (P7Y79_04615) | - | 955410..956239 (-) | 830 | Protein_914 | IS30 family transposase | - |
| P7Y79_RS04620 (P7Y79_04620) | - | 956308..956550 (+) | 243 | Protein_915 | transposase | - |
| P7Y79_RS04625 (P7Y79_04625) | - | 956807..956944 (+) | 138 | WP_174235035.1 | hypothetical protein | - |
| P7Y79_RS04630 (P7Y79_04630) | - | 957096..957431 (+) | 336 | WP_278007130.1 | hypothetical protein | - |
| P7Y79_RS04635 (P7Y79_04635) | - | 958019..958252 (+) | 234 | Protein_918 | DNA-binding protein | - |
| P7Y79_RS04640 (P7Y79_04640) | - | 958323..959755 (+) | 1433 | Protein_919 | site-specific integrase | - |
| P7Y79_RS04645 (P7Y79_04645) | ylqF | 959846..960700 (+) | 855 | WP_039696900.1 | ribosome biogenesis GTPase YlqF | - |
| P7Y79_RS04650 (P7Y79_04650) | - | 960687..961466 (+) | 780 | WP_158913825.1 | ribonuclease HII | - |
| P7Y79_RS04655 (P7Y79_04655) | - | 961467..962018 (+) | 552 | WP_006532135.1 | sugar O-acetyltransferase | - |
| P7Y79_RS04660 (P7Y79_04660) | dprA | 962089..962931 (+) | 843 | WP_157629020.1 | DNA-processing protein DprA | Machinery gene |
| P7Y79_RS04665 (P7Y79_04665) | topA | 963026..965164 (+) | 2139 | WP_074601924.1 | type I DNA topoisomerase | - |
| P7Y79_RS04670 (P7Y79_04670) | - | 965309..965974 (+) | 666 | WP_278007131.1 | SatD family protein | - |
| P7Y79_RS04675 (P7Y79_04675) | - | 965974..966696 (+) | 723 | WP_157629018.1 | DUF3307 domain-containing protein | - |
| P7Y79_RS04680 (P7Y79_04680) | - | 966708..967190 (+) | 483 | WP_081341832.1 | hypothetical protein | - |
| P7Y79_RS04685 (P7Y79_04685) | trmFO | 967364..968701 (+) | 1338 | WP_158913820.1 | methylenetetrahydrofolate--tRNA-(uracil(54)- C(5))-methyltransferase (FADH(2)-oxidizing) TrmFO | - |
| P7Y79_RS04690 (P7Y79_04690) | - | 968730..969551 (+) | 822 | WP_278007132.1 | TIM barrel protein | - |
| P7Y79_RS04695 (P7Y79_04695) | - | 970002..970754 (+) | 753 | WP_158913814.1 | ABC transporter ATP-binding protein | - |
| P7Y79_RS04700 (P7Y79_04700) | - | 970756..972732 (+) | 1977 | WP_158913811.1 | FtsX-like permease family protein | - |
| P7Y79_RS04705 (P7Y79_04705) | - | 972834..973496 (+) | 663 | WP_158913808.1 | response regulator transcription factor | - |
| P7Y79_RS04710 (P7Y79_04710) | - | 973493..974440 (+) | 948 | WP_278007133.1 | sensor histidine kinase | - |
| P7Y79_RS04715 (P7Y79_04715) | - | 974521..975201 (+) | 681 | WP_278007134.1 | XRE family transcriptional regulator | - |
| P7Y79_RS04720 (P7Y79_04720) | xerS | 975307..976377 (-) | 1071 | WP_278007135.1 | tyrosine recombinase XerS | - |
| P7Y79_RS04725 (P7Y79_04725) | - | 976704..978089 (-) | 1386 | WP_278007136.1 | ABC transporter ATP-binding protein | - |
| P7Y79_RS04730 (P7Y79_04730) | - | 978094..978789 (-) | 696 | WP_278007137.1 | energy-coupling factor transporter transmembrane component T | - |
| P7Y79_RS04735 (P7Y79_04735) | - | 978837..979424 (-) | 588 | WP_278007138.1 | MptD family putative ECF transporter S component | - |
| P7Y79_RS04740 (P7Y79_04740) | - | 979434..981167 (-) | 1734 | WP_278007139.1 | ABC transporter ATP-binding protein | - |
| P7Y79_RS04745 (P7Y79_04745) | - | 981164..982900 (-) | 1737 | WP_278007837.1 | ABC transporter ATP-binding protein | - |
| P7Y79_RS04750 (P7Y79_04750) | - | 983072..984085 (+) | 1014 | WP_278007140.1 | AraC family transcriptional regulator | - |
| P7Y79_RS04755 (P7Y79_04755) | - | 984120..984428 (-) | 309 | WP_278007141.1 | DUF4176 domain-containing protein | - |
| P7Y79_RS04760 (P7Y79_04760) | - | 984421..985197 (-) | 777 | WP_278007142.1 | hypothetical protein | - |
| P7Y79_RS04765 (P7Y79_04765) | - | 985187..986737 (-) | 1551 | WP_278007143.1 | T7SS effector LXG polymorphic toxin | - |
| P7Y79_RS04770 (P7Y79_04770) | ffh | 986852..988417 (-) | 1566 | WP_021142268.1 | signal recognition particle protein | - |
| P7Y79_RS04775 (P7Y79_04775) | - | 988464..988796 (-) | 333 | WP_004231629.1 | putative DNA-binding protein | - |
| P7Y79_RS04780 (P7Y79_04780) | - | 989098..989796 (-) | 699 | WP_278007144.1 | GntR family transcriptional regulator | - |
| P7Y79_RS04785 (P7Y79_04785) | - | 989956..993819 (-) | 3864 | WP_278007145.1 | DNA-binding protein | - |
| P7Y79_RS04790 (P7Y79_04790) | - | 993844..995574 (-) | 1731 | WP_278007146.1 | DUF2075 domain-containing protein | - |
| P7Y79_RS04795 (P7Y79_04795) | - | 995704..995880 (-) | 177 | WP_278007147.1 | hypothetical protein | - |
| P7Y79_RS04800 (P7Y79_04800) | - | 995901..996260 (-) | 360 | WP_278007148.1 | hypothetical protein | - |
| P7Y79_RS04805 (P7Y79_04805) | - | 996263..997678 (-) | 1416 | WP_278007149.1 | Y-family DNA polymerase | - |
| P7Y79_RS04810 (P7Y79_04810) | - | 997679..997882 (-) | 204 | WP_074482210.1 | hypothetical protein | - |
| P7Y79_RS04815 (P7Y79_04815) | - | 997884..998570 (-) | 687 | WP_278007150.1 | LexA family transcriptional regulator | - |
| P7Y79_RS04820 (P7Y79_04820) | dhaM | 998782..999159 (-) | 378 | WP_074560098.1 | dihydroxyacetone kinase phosphoryl donor subunit DhaM | - |
| P7Y79_RS04825 (P7Y79_04825) | dhaL | 999152..999742 (-) | 591 | WP_157628999.1 | dihydroxyacetone kinase subunit DhaL | - |
| P7Y79_RS04830 (P7Y79_04830) | - | 999900..1001225 (-) | 1326 | WP_157628998.1 | MATE family efflux transporter | - |
| P7Y79_RS04835 (P7Y79_04835) | - | 1001376..1002038 (-) | 663 | WP_238385891.1 | CPBP family intramembrane glutamic endopeptidase | - |
| P7Y79_RS04840 (P7Y79_04840) | - | 1002079..1005441 (-) | 3363 | WP_278007151.1 | DEAD/DEAH box helicase family protein | - |
| P7Y79_RS04845 (P7Y79_04845) | - | 1005510..1006598 (-) | 1089 | WP_278007152.1 | restriction endonuclease subunit S | - |
| P7Y79_RS04850 (P7Y79_04850) | xerA | 1006640..1007608 (-) | 969 | WP_278007153.1 | site-specific tyrosine recombinase/integron integrase | - |
| P7Y79_RS04855 (P7Y79_04855) | - | 1007653..1008816 (-) | 1164 | WP_278007154.1 | restriction endonuclease subunit S | - |
| P7Y79_RS04860 (P7Y79_04860) | - | 1008863..1010365 (-) | 1503 | WP_278007155.1 | class I SAM-dependent DNA methyltransferase | - |
Sequence
Protein
Download Length: 280 a.a. Molecular weight: 31098.07 Da Isoelectric Point: 9.1791
>NTDB_id=811103 P7Y79_RS04660 WP_157629020.1 962089..962931(+) (dprA) [Streptococcus ruminicola strain CNU_77-47]
MNNFELFKLKQAGLTNLNILTILDYQKREKKSLSLRDMAVVSKCKNPILFIEKYKDLDSKTLRKVFNQYPSISILDDDYP
LELKHSYNPPVLLFYKGNIELLNRPKMAVVGARTATQTGTKSVQKIIKELGNQFVIVSGLARGIDTSAHISALKNGGATI
AVIGCGLDVYYPKENKQLQDYLGKNHLILSEYTAVEAPLKYHFPERNRIIAGLSQGVIVAEAKLRSGSLITCERALEEGR
DVFAIPGNILDGKSDGCHHLIKEGAKCITSGLDVLSEYQL
MNNFELFKLKQAGLTNLNILTILDYQKREKKSLSLRDMAVVSKCKNPILFIEKYKDLDSKTLRKVFNQYPSISILDDDYP
LELKHSYNPPVLLFYKGNIELLNRPKMAVVGARTATQTGTKSVQKIIKELGNQFVIVSGLARGIDTSAHISALKNGGATI
AVIGCGLDVYYPKENKQLQDYLGKNHLILSEYTAVEAPLKYHFPERNRIIAGLSQGVIVAEAKLRSGSLITCERALEEGR
DVFAIPGNILDGKSDGCHHLIKEGAKCITSGLDVLSEYQL
Nucleotide
Download Length: 843 bp
>NTDB_id=811103 P7Y79_RS04660 WP_157629020.1 962089..962931(+) (dprA) [Streptococcus ruminicola strain CNU_77-47]
ATGAATAATTTTGAACTATTTAAATTAAAACAAGCAGGACTAACAAATCTCAATATTCTAACCATTTTAGATTATCAAAA
GCGAGAGAAGAAATCTCTTTCCTTGCGCGATATGGCAGTTGTGTCCAAATGTAAGAATCCTATTCTATTTATAGAAAAAT
ACAAAGATTTGGATAGTAAAACTTTGCGAAAAGTCTTTAACCAATACCCTAGTATTTCAATACTAGATGACGACTATCCG
CTGGAATTAAAACATTCTTATAATCCGCCTGTTTTGCTTTTTTATAAAGGCAATATTGAGCTACTCAATCGTCCAAAAAT
GGCAGTAGTAGGAGCACGCACAGCCACACAGACAGGAACCAAGTCCGTTCAAAAAATTATCAAAGAACTTGGAAATCAAT
TCGTCATTGTCAGTGGCTTAGCTAGAGGAATCGATACCAGCGCACATATTTCAGCCCTAAAAAATGGCGGAGCGACAATA
GCAGTTATTGGTTGTGGTCTTGACGTCTATTACCCCAAAGAAAACAAGCAGTTGCAGGACTACCTTGGAAAAAATCATTT
GATTTTAAGTGAATACACAGCAGTAGAAGCGCCACTAAAATACCATTTTCCAGAACGCAATCGCATTATCGCAGGGTTAT
CCCAAGGCGTCATAGTAGCAGAAGCTAAATTGCGATCTGGCAGCTTAATTACTTGTGAGCGAGCCCTAGAAGAAGGACGA
GACGTTTTTGCCATTCCAGGTAATATTTTAGACGGAAAATCTGACGGATGTCATCATTTGATCAAAGAAGGCGCAAAGTG
CATCACATCAGGCTTAGACGTCCTTTCAGAGTACCAATTGTAA
ATGAATAATTTTGAACTATTTAAATTAAAACAAGCAGGACTAACAAATCTCAATATTCTAACCATTTTAGATTATCAAAA
GCGAGAGAAGAAATCTCTTTCCTTGCGCGATATGGCAGTTGTGTCCAAATGTAAGAATCCTATTCTATTTATAGAAAAAT
ACAAAGATTTGGATAGTAAAACTTTGCGAAAAGTCTTTAACCAATACCCTAGTATTTCAATACTAGATGACGACTATCCG
CTGGAATTAAAACATTCTTATAATCCGCCTGTTTTGCTTTTTTATAAAGGCAATATTGAGCTACTCAATCGTCCAAAAAT
GGCAGTAGTAGGAGCACGCACAGCCACACAGACAGGAACCAAGTCCGTTCAAAAAATTATCAAAGAACTTGGAAATCAAT
TCGTCATTGTCAGTGGCTTAGCTAGAGGAATCGATACCAGCGCACATATTTCAGCCCTAAAAAATGGCGGAGCGACAATA
GCAGTTATTGGTTGTGGTCTTGACGTCTATTACCCCAAAGAAAACAAGCAGTTGCAGGACTACCTTGGAAAAAATCATTT
GATTTTAAGTGAATACACAGCAGTAGAAGCGCCACTAAAATACCATTTTCCAGAACGCAATCGCATTATCGCAGGGTTAT
CCCAAGGCGTCATAGTAGCAGAAGCTAAATTGCGATCTGGCAGCTTAATTACTTGTGAGCGAGCCCTAGAAGAAGGACGA
GACGTTTTTGCCATTCCAGGTAATATTTTAGACGGAAAATCTGACGGATGTCATCATTTGATCAAAGAAGGCGCAAAGTG
CATCACATCAGGCTTAGACGTCCTTTCAGAGTACCAATTGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| dprA | Streptococcus mutans UA159 |
73.571 |
100 |
0.736 |
| dprA/cilB/dalA | Streptococcus pneumoniae Rx1 |
63.214 |
100 |
0.632 |
| dprA/cilB/dalA | Streptococcus pneumoniae D39 |
63.214 |
100 |
0.632 |
| dprA/cilB/dalA | Streptococcus pneumoniae R6 |
63.214 |
100 |
0.632 |
| dprA/cilB/dalA | Streptococcus pneumoniae TIGR4 |
63.214 |
100 |
0.632 |
| dprA/cilB/dalA | Streptococcus mitis SK321 |
63.214 |
100 |
0.632 |
| dprA/cilB/dalA | Streptococcus mitis NCTC 12261 |
62.857 |
100 |
0.629 |
| dprA | Lactococcus lactis subsp. cremoris KW2 |
60.072 |
99.286 |
0.596 |
| dprA | Legionella pneumophila strain ERS1305867 |
38.908 |
100 |
0.407 |