Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | P7F77_RS05805 | Genome accession | NZ_CP121204 |
| Coordinates | 1175792..1176262 (+) | Length | 156 a.a. |
| NCBI ID | WP_031810763.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain SA0907 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1164739..1208284 | 1175792..1176262 | within | 0 |
Gene organization within MGE regions
Location: 1164739..1208284
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P7F77_RS05710 (P7F77_05710) | - | 1164739..1166124 (-) | 1386 | WP_000861313.1 | recombinase family protein | - |
| P7F77_RS05715 (P7F77_05715) | - | 1166331..1167011 (-) | 681 | WP_000392109.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| P7F77_RS05720 (P7F77_05720) | - | 1167043..1167507 (-) | 465 | WP_000525003.1 | hypothetical protein | - |
| P7F77_RS05725 (P7F77_05725) | - | 1167520..1167849 (-) | 330 | WP_001573842.1 | helix-turn-helix transcriptional regulator | - |
| P7F77_RS05730 (P7F77_05730) | - | 1168041..1168286 (+) | 246 | WP_001573844.1 | helix-turn-helix transcriptional regulator | - |
| P7F77_RS05735 (P7F77_05735) | - | 1168300..1169076 (+) | 777 | WP_278043635.1 | Rha family transcriptional regulator | - |
| P7F77_RS05740 (P7F77_05740) | - | 1169105..1169248 (+) | 144 | WP_000939498.1 | hypothetical protein | - |
| P7F77_RS05745 (P7F77_05745) | - | 1169238..1169447 (-) | 210 | WP_000642492.1 | hypothetical protein | - |
| P7F77_RS05750 (P7F77_05750) | - | 1169504..1170280 (+) | 777 | WP_224209363.1 | phage antirepressor KilAC domain-containing protein | - |
| P7F77_RS05755 (P7F77_05755) | - | 1170297..1170491 (+) | 195 | WP_000390105.1 | hypothetical protein | - |
| P7F77_RS05760 (P7F77_05760) | - | 1170695..1170925 (-) | 231 | WP_000395457.1 | hypothetical protein | - |
| P7F77_RS05765 (P7F77_05765) | - | 1170984..1171112 (+) | 129 | WP_001559112.1 | hypothetical protein | - |
| P7F77_RS05770 (P7F77_05770) | - | 1171105..1171272 (+) | 168 | WP_001285957.1 | DUF1270 domain-containing protein | - |
| P7F77_RS05775 (P7F77_05775) | - | 1171273..1171593 (+) | 321 | WP_000219666.1 | hypothetical protein | - |
| P7F77_RS05780 (P7F77_05780) | - | 1171687..1171947 (+) | 261 | WP_000291075.1 | DUF1108 family protein | - |
| P7F77_RS05785 (P7F77_05785) | - | 1171956..1172219 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| P7F77_RS05790 (P7F77_05790) | - | 1172228..1174171 (+) | 1944 | WP_000700555.1 | AAA family ATPase | - |
| P7F77_RS05795 (P7F77_05795) | - | 1174173..1175093 (+) | 921 | WP_000138472.1 | recombinase RecT | - |
| P7F77_RS05800 (P7F77_05800) | - | 1175174..1175791 (+) | 618 | WP_071621397.1 | MBL fold metallo-hydrolase | - |
| P7F77_RS05805 (P7F77_05805) | ssbA | 1175792..1176262 (+) | 471 | WP_031810763.1 | single-stranded DNA-binding protein | Machinery gene |
| P7F77_RS05810 (P7F77_05810) | - | 1176292..1177179 (+) | 888 | WP_000148306.1 | DnaD domain protein | - |
| P7F77_RS05815 (P7F77_05815) | - | 1177186..1177404 (+) | 219 | WP_000338528.1 | hypothetical protein | - |
| P7F77_RS05820 (P7F77_05820) | - | 1177413..1177722 (+) | 310 | Protein_1138 | RusA family crossover junction endodeoxyribonuclease | - |
| P7F77_RS05825 (P7F77_05825) | - | 1177735..1178103 (+) | 369 | WP_000101274.1 | SA1788 family PVL leukocidin-associated protein | - |
| P7F77_RS05830 (P7F77_05830) | - | 1178107..1178349 (+) | 243 | WP_000131366.1 | SAV1978 family virulence-associated passenger protein | - |
| P7F77_RS05835 (P7F77_05835) | - | 1178361..1178528 (+) | 168 | WP_001624242.1 | hypothetical protein | - |
| P7F77_RS05840 (P7F77_05840) | - | 1178521..1178769 (+) | 249 | WP_278043745.1 | DUF1024 family protein | - |
| P7F77_RS05845 (P7F77_05845) | - | 1178762..1179298 (+) | 537 | WP_031789556.1 | dUTPase | - |
| P7F77_RS05850 (P7F77_05850) | - | 1179335..1179508 (+) | 174 | WP_001209219.1 | hypothetical protein | - |
| P7F77_RS05855 (P7F77_05855) | - | 1179525..1179731 (+) | 207 | WP_031786300.1 | DUF1381 domain-containing protein | - |
| P7F77_RS05860 (P7F77_05860) | - | 1179728..1179922 (+) | 195 | WP_000132920.1 | hypothetical protein | - |
| P7F77_RS05865 (P7F77_05865) | - | 1179919..1180122 (+) | 204 | WP_001072795.1 | hypothetical protein | - |
| P7F77_RS05870 (P7F77_05870) | - | 1180115..1180351 (+) | 237 | WP_000608273.1 | hypothetical protein | - |
| P7F77_RS05875 (P7F77_05875) | - | 1180341..1180727 (+) | 387 | WP_001555739.1 | hypothetical protein | - |
| P7F77_RS05880 (P7F77_05880) | - | 1180727..1180900 (+) | 174 | WP_000595244.1 | transcriptional activator RinB | - |
| P7F77_RS05885 (P7F77_05885) | - | 1180901..1181047 (+) | 147 | WP_000990001.1 | hypothetical protein | - |
| P7F77_RS05890 (P7F77_05890) | - | 1181071..1181493 (+) | 423 | WP_000162696.1 | RinA family phage transcriptional activator | - |
| P7F77_RS05895 (P7F77_05895) | - | 1181680..1182120 (+) | 441 | WP_001003272.1 | terminase small subunit | - |
| P7F77_RS05900 (P7F77_05900) | - | 1182107..1183384 (+) | 1278 | WP_000169945.1 | PBSX family phage terminase large subunit | - |
| P7F77_RS05905 (P7F77_05905) | - | 1183395..1184933 (+) | 1539 | WP_001568999.1 | phage portal protein | - |
| P7F77_RS05910 (P7F77_05910) | - | 1184940..1185935 (+) | 996 | WP_031794387.1 | minor capsid protein | - |
| P7F77_RS05915 (P7F77_05915) | - | 1186008..1186178 (+) | 171 | WP_000072208.1 | hypothetical protein | - |
| P7F77_RS05920 (P7F77_05920) | - | 1186206..1186299 (+) | 94 | Protein_1158 | hypothetical protein | - |
| P7F77_RS05925 (P7F77_05925) | - | 1186287..1186907 (+) | 621 | WP_001668927.1 | DUF4355 domain-containing protein | - |
| P7F77_RS05930 (P7F77_05930) | - | 1186921..1187895 (+) | 975 | WP_000438513.1 | phage major capsid protein | - |
| P7F77_RS05935 (P7F77_05935) | - | 1187917..1188204 (+) | 288 | WP_031771475.1 | hypothetical protein | - |
| P7F77_RS05940 (P7F77_05940) | - | 1188213..1188545 (+) | 333 | WP_000208960.1 | phage head-tail connector protein | - |
| P7F77_RS05945 (P7F77_05945) | - | 1188542..1188844 (+) | 303 | WP_009560319.1 | hypothetical protein | - |
| P7F77_RS05950 (P7F77_05950) | - | 1188844..1189191 (+) | 348 | WP_001017811.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| P7F77_RS05955 (P7F77_05955) | - | 1189203..1189586 (+) | 384 | WP_000188653.1 | hypothetical protein | - |
| P7F77_RS05960 (P7F77_05960) | - | 1189605..1190186 (+) | 582 | WP_000002583.1 | phage major tail protein, TP901-1 family | - |
| P7F77_RS05965 (P7F77_05965) | - | 1190248..1190613 (+) | 366 | WP_001100163.1 | tail assembly chaperone | - |
| P7F77_RS05970 (P7F77_05970) | - | 1190643..1190987 (+) | 345 | WP_000105584.1 | hypothetical protein | - |
| P7F77_RS05975 (P7F77_05975) | - | 1191004..1194468 (+) | 3465 | WP_031881830.1 | membrane protein | - |
| P7F77_RS05980 (P7F77_05980) | - | 1194481..1195428 (+) | 948 | WP_031881831.1 | phage tail family protein | - |
| P7F77_RS05985 (P7F77_05985) | - | 1195437..1197338 (+) | 1902 | WP_031783966.1 | SGNH/GDSL hydrolase family protein | - |
| P7F77_RS05990 (P7F77_05990) | - | 1197353..1199263 (+) | 1911 | WP_031898410.1 | hypothetical protein | - |
| P7F77_RS05995 (P7F77_05995) | - | 1199263..1201086 (+) | 1824 | WP_000259596.1 | phage baseplate upper protein | - |
| P7F77_RS06000 (P7F77_06000) | - | 1201086..1201463 (+) | 378 | WP_000705902.1 | DUF2977 domain-containing protein | - |
| P7F77_RS06005 (P7F77_06005) | - | 1201467..1201640 (+) | 174 | WP_001800921.1 | XkdX family protein | - |
| P7F77_RS06010 (P7F77_06010) | - | 1201681..1201980 (+) | 300 | WP_000466767.1 | DUF2951 domain-containing protein | - |
| P7F77_RS06015 (P7F77_06015) | - | 1202117..1204015 (+) | 1899 | WP_138936742.1 | glucosaminidase domain-containing protein | - |
| P7F77_RS06020 (P7F77_06020) | - | 1204028..1205200 (+) | 1173 | WP_000276624.1 | BppU family phage baseplate upper protein | - |
| P7F77_RS06025 (P7F77_06025) | - | 1205206..1205601 (+) | 396 | WP_000398882.1 | hypothetical protein | - |
| P7F77_RS06030 (P7F77_06030) | - | 1205658..1206095 (+) | 438 | WP_000354135.1 | phage holin | - |
| P7F77_RS06035 (P7F77_06035) | - | 1206076..1207521 (+) | 1446 | WP_001148142.1 | SH3 domain-containing protein | - |
| P7F77_RS06040 (P7F77_06040) | - | 1207764..1207916 (+) | 153 | WP_001788502.1 | hypothetical protein | - |
| P7F77_RS06045 (P7F77_06045) | - | 1207987..1208097 (+) | 111 | WP_000139423.1 | hypothetical protein | - |
| P7F77_RS06050 (P7F77_06050) | - | 1208099..1208284 (+) | 186 | WP_001286805.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17717.62 Da Isoelectric Point: 4.9816
>NTDB_id=811037 P7F77_RS05805 WP_031810763.1 1175792..1176262(+) (ssbA) [Staphylococcus aureus strain SA0907]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYKQQAQQSRGQSQYPYNKPVKDNPFANANDPIEIDDDDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYKQQAQQSRGQSQYPYNKPVKDNPFANANDPIEIDDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=811037 P7F77_RS05805 WP_031810763.1 1175792..1176262(+) (ssbA) [Staphylococcus aureus strain SA0907]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACAAACAACAAGCGCAACAATCACGTGGACAGTCTCAATATCCATATAACAAAC
CAGTAAAAGATAATCCGTTCGCAAATGCGAATGATCCTATTGAAATAGATGACGATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACAAACAACAAGCGCAACAATCACGTGGACAGTCTCAATATCCATATAACAAAC
CAGTAAAAGATAATCCGTTCGCAAATGCGAATGATCCTATTGAAATAGATGACGATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.765 |
100 |
0.564 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Neisseria meningitidis MC58 |
33.526 |
100 |
0.372 |
| ssb | Neisseria gonorrhoeae MS11 |
33.526 |
100 |
0.372 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |