Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | P3U36_RS12075 | Genome accession | NZ_CP120056 |
| Coordinates | 2470023..2470460 (-) | Length | 145 a.a. |
| NCBI ID | WP_020219716.1 | Uniprot ID | - |
| Organism | Staphylococcus pseudintermedius strain Dog129 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2434702..2477328 | 2470023..2470460 | within | 0 |
Gene organization within MGE regions
Location: 2434702..2477328
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P3U36_RS11805 (P3U36_11805) | - | 2434702..2435094 (-) | 393 | WP_315991075.1 | hypothetical protein | - |
| P3U36_RS13960 | - | 2435224..2435376 (+) | 153 | WP_082239529.1 | ribbon-helix-helix domain-containing protein | - |
| P3U36_RS11810 (P3U36_11810) | - | 2435373..2435723 (+) | 351 | WP_065354563.1 | hypothetical protein | - |
| P3U36_RS11815 (P3U36_11815) | - | 2435769..2437157 (-) | 1389 | WP_100004561.1 | N-acetylmuramoyl-L-alanine amidase | - |
| P3U36_RS11820 (P3U36_11820) | - | 2437171..2437476 (-) | 306 | WP_100004560.1 | phage holin | - |
| P3U36_RS11825 (P3U36_11825) | - | 2437542..2437685 (-) | 144 | WP_096535907.1 | XkdX family protein | - |
| P3U36_RS11830 (P3U36_11830) | - | 2437678..2438004 (-) | 327 | WP_065354567.1 | hypothetical protein | - |
| P3U36_RS11835 (P3U36_11835) | - | 2438017..2439078 (-) | 1062 | WP_103926912.1 | BppU family phage baseplate upper protein | - |
| P3U36_RS11840 (P3U36_11840) | - | 2439087..2440973 (-) | 1887 | WP_322214694.1 | glucosaminidase domain-containing protein | - |
| P3U36_RS11845 (P3U36_11845) | - | 2441102..2441401 (-) | 300 | WP_065354570.1 | DUF2951 family protein | - |
| P3U36_RS11850 (P3U36_11850) | - | 2441440..2441589 (-) | 150 | WP_019166734.1 | XkdX family protein | - |
| P3U36_RS11855 (P3U36_11855) | - | 2441591..2442016 (-) | 426 | WP_096535913.1 | hypothetical protein | - |
| P3U36_RS11860 (P3U36_11860) | - | 2442016..2443515 (-) | 1500 | WP_322214695.1 | BppU family phage baseplate upper protein | - |
| P3U36_RS11865 (P3U36_11865) | - | 2443517..2445472 (-) | 1956 | WP_310464793.1 | right-handed parallel beta-helix repeat-containing protein | - |
| P3U36_RS11870 (P3U36_11870) | - | 2445475..2446977 (-) | 1503 | WP_322214696.1 | phage tail protein | - |
| P3U36_RS11875 (P3U36_11875) | - | 2446986..2447900 (-) | 915 | WP_310464791.1 | phage tail domain-containing protein | - |
| P3U36_RS11880 (P3U36_11880) | - | 2447918..2450923 (-) | 3006 | WP_322214697.1 | terminase | - |
| P3U36_RS11885 (P3U36_11885) | - | 2450926..2451207 (-) | 282 | WP_019166741.1 | hypothetical protein | - |
| P3U36_RS11890 (P3U36_11890) | - | 2451276..2451773 (-) | 498 | WP_065354578.1 | tail assembly chaperone | - |
| P3U36_RS11895 (P3U36_11895) | - | 2451834..2452430 (-) | 597 | WP_065354579.1 | phage tail protein | - |
| P3U36_RS11900 (P3U36_11900) | - | 2452435..2452857 (-) | 423 | WP_310464789.1 | DUF3168 domain-containing protein | - |
| P3U36_RS11905 (P3U36_11905) | - | 2452868..2453281 (-) | 414 | WP_096535929.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| P3U36_RS11910 (P3U36_11910) | - | 2453268..2453603 (-) | 336 | WP_096535930.1 | phage head closure protein | - |
| P3U36_RS11915 (P3U36_11915) | - | 2453605..2453901 (-) | 297 | WP_019167201.1 | phage head-tail connector protein | - |
| P3U36_RS11920 (P3U36_11920) | - | 2453901..2454185 (-) | 285 | WP_019167202.1 | Rho termination factor N-terminal domain-containing protein | - |
| P3U36_RS11925 (P3U36_11925) | - | 2454202..2455038 (-) | 837 | WP_322214698.1 | N4-gp56 family major capsid protein | - |
| P3U36_RS11930 (P3U36_11930) | - | 2455059..2455649 (-) | 591 | WP_096535934.1 | phage scaffolding protein | - |
| P3U36_RS11935 (P3U36_11935) | - | 2455765..2455941 (-) | 177 | WP_179300483.1 | hypothetical protein | - |
| P3U36_RS11940 (P3U36_11940) | - | 2455945..2456895 (-) | 951 | WP_322214699.1 | phage head morphogenesis protein | - |
| P3U36_RS11945 (P3U36_11945) | - | 2456864..2458288 (-) | 1425 | WP_100004551.1 | phage portal protein | - |
| P3U36_RS11950 (P3U36_11950) | - | 2458289..2459554 (-) | 1266 | WP_065354586.1 | PBSX family phage terminase large subunit | - |
| P3U36_RS11955 (P3U36_11955) | - | 2459538..2460026 (-) | 489 | WP_065354587.1 | terminase small subunit | - |
| P3U36_RS11960 (P3U36_11960) | - | 2460325..2460744 (-) | 420 | WP_065354588.1 | transcriptional regulator | - |
| P3U36_RS11965 (P3U36_11965) | - | 2460747..2460899 (-) | 153 | WP_158004123.1 | hypothetical protein | - |
| P3U36_RS11970 (P3U36_11970) | rinB | 2460899..2461069 (-) | 171 | WP_065354589.1 | transcriptional activator RinB | - |
| P3U36_RS11975 (P3U36_11975) | - | 2461085..2461273 (-) | 189 | WP_037542749.1 | DUF1381 domain-containing protein | - |
| P3U36_RS11980 (P3U36_11980) | - | 2461270..2461734 (-) | 465 | WP_187530297.1 | class I SAM-dependent methyltransferase | - |
| P3U36_RS11985 (P3U36_11985) | - | 2461798..2462334 (-) | 537 | WP_322214701.1 | dUTP pyrophosphatase | - |
| P3U36_RS11990 (P3U36_11990) | - | 2462327..2462482 (-) | 156 | WP_015978034.1 | hypothetical protein | - |
| P3U36_RS11995 (P3U36_11995) | - | 2462484..2462963 (-) | 480 | WP_187526041.1 | hypothetical protein | - |
| P3U36_RS12000 (P3U36_12000) | - | 2462964..2463179 (-) | 216 | WP_065354485.1 | hypothetical protein | - |
| P3U36_RS12005 (P3U36_12005) | - | 2463179..2463574 (-) | 396 | WP_322214381.1 | hypothetical protein | - |
| P3U36_RS12010 (P3U36_12010) | - | 2463574..2463822 (-) | 249 | WP_020219705.1 | hypothetical protein | - |
| P3U36_RS12015 (P3U36_12015) | - | 2463822..2463998 (-) | 177 | WP_019169002.1 | hypothetical protein | - |
| P3U36_RS12020 (P3U36_12020) | - | 2463968..2464948 (-) | 981 | WP_214546336.1 | DNA cytosine methyltransferase | - |
| P3U36_RS12025 (P3U36_12025) | - | 2464955..2465206 (-) | 252 | WP_136083996.1 | SAV1978 family virulence-associated passenger protein | - |
| P3U36_RS12030 (P3U36_12030) | - | 2465203..2465682 (-) | 480 | WP_322214702.1 | DUF3310 domain-containing protein | - |
| P3U36_RS12035 (P3U36_12035) | - | 2465839..2466165 (-) | 327 | WP_020219709.1 | hypothetical protein | - |
| P3U36_RS12040 (P3U36_12040) | - | 2466179..2466397 (-) | 219 | WP_020219710.1 | hypothetical protein | - |
| P3U36_RS12045 (P3U36_12045) | - | 2466366..2466815 (-) | 450 | WP_140237919.1 | RusA family crossover junction endodeoxyribonuclease | - |
| P3U36_RS12050 (P3U36_12050) | - | 2466802..2467020 (-) | 219 | WP_140237918.1 | hypothetical protein | - |
| P3U36_RS12055 (P3U36_12055) | - | 2467017..2468261 (-) | 1245 | WP_322214703.1 | DnaB helicase C-terminal domain-containing protein | - |
| P3U36_RS12060 (P3U36_12060) | - | 2468254..2468601 (-) | 348 | WP_065354055.1 | hypothetical protein | - |
| P3U36_RS12065 (P3U36_12065) | - | 2468606..2469334 (-) | 729 | WP_322214704.1 | helix-turn-helix domain-containing protein | - |
| P3U36_RS12070 (P3U36_12070) | - | 2469327..2470001 (-) | 675 | WP_140237916.1 | putative HNHc nuclease | - |
| P3U36_RS12075 (P3U36_12075) | ssbA | 2470023..2470460 (-) | 438 | WP_020219716.1 | single-stranded DNA-binding protein | Machinery gene |
| P3U36_RS12080 (P3U36_12080) | - | 2470460..2471128 (-) | 669 | WP_110165143.1 | ERF family protein | - |
| P3U36_RS12085 (P3U36_12085) | - | 2471130..2471678 (-) | 549 | WP_322214705.1 | host-nuclease inhibitor Gam family protein | - |
| P3U36_RS12090 (P3U36_12090) | - | 2471671..2471925 (-) | 255 | WP_100005313.1 | hypothetical protein | - |
| P3U36_RS12095 (P3U36_12095) | - | 2471937..2472197 (-) | 261 | WP_020219720.1 | DUF1108 family protein | - |
| P3U36_RS12100 (P3U36_12100) | - | 2472570..2473283 (-) | 714 | WP_310464816.1 | BRO family protein | - |
| P3U36_RS12105 (P3U36_12105) | - | 2473314..2473757 (-) | 444 | WP_065354605.1 | hypothetical protein | - |
| P3U36_RS12110 (P3U36_12110) | - | 2473770..2474009 (-) | 240 | WP_019165844.1 | helix-turn-helix transcriptional regulator | - |
| P3U36_RS12115 (P3U36_12115) | - | 2474180..2474878 (+) | 699 | WP_310464817.1 | helix-turn-helix domain-containing protein | - |
| P3U36_RS12120 (P3U36_12120) | - | 2474890..2475057 (+) | 168 | WP_203160692.1 | hypothetical protein | - |
| P3U36_RS12125 (P3U36_12125) | - | 2475070..2475885 (+) | 816 | WP_100005314.1 | DUF5067 domain-containing protein | - |
| P3U36_RS12130 (P3U36_12130) | - | 2475943..2477328 (+) | 1386 | WP_100005315.1 | recombinase family protein | - |
Sequence
Protein
Download Length: 145 a.a. Molecular weight: 16199.96 Da Isoelectric Point: 4.9221
>NTDB_id=802331 P3U36_RS12075 WP_020219716.1 2470023..2470460(-) (ssbA) [Staphylococcus pseudintermedius strain Dog129]
MLNRTVLVGRLTKDPDFRTTPSGVEVATFTLAVNRNFKSKDGEQQADFINCVVFKKQAENVKNYLSKGSLAGVDGRLQSR
SYENQEGRRVYVTEVICDSVQFLEPKSNNQSNNQPQQQRGQAPAQDNPFAIANGPIDIDDDDMPF
MLNRTVLVGRLTKDPDFRTTPSGVEVATFTLAVNRNFKSKDGEQQADFINCVVFKKQAENVKNYLSKGSLAGVDGRLQSR
SYENQEGRRVYVTEVICDSVQFLEPKSNNQSNNQPQQQRGQAPAQDNPFAIANGPIDIDDDDMPF
Nucleotide
Download Length: 438 bp
>NTDB_id=802331 P3U36_RS12075 WP_020219716.1 2470023..2470460(-) (ssbA) [Staphylococcus pseudintermedius strain Dog129]
ATGTTAAACAGAACTGTATTGGTTGGTCGATTAACAAAAGACCCTGATTTCAGAACAACGCCGTCAGGTGTAGAGGTTGC
GACATTTACATTAGCAGTAAATAGAAATTTTAAATCTAAAGACGGTGAACAACAAGCGGACTTTATCAACTGTGTTGTAT
TCAAAAAACAAGCAGAAAATGTCAAAAACTATTTAAGTAAAGGTAGTTTAGCCGGTGTTGATGGTCGCCTACAATCACGT
AGTTACGAAAATCAAGAGGGGCGACGTGTGTATGTAACAGAAGTAATTTGTGATAGCGTGCAGTTTTTAGAGCCTAAAAG
TAACAATCAGTCTAACAATCAACCGCAGCAACAAAGAGGTCAAGCACCTGCGCAAGATAATCCTTTCGCTATCGCAAACG
GTCCGATTGATATCGATGATGACGATATGCCCTTTTAA
ATGTTAAACAGAACTGTATTGGTTGGTCGATTAACAAAAGACCCTGATTTCAGAACAACGCCGTCAGGTGTAGAGGTTGC
GACATTTACATTAGCAGTAAATAGAAATTTTAAATCTAAAGACGGTGAACAACAAGCGGACTTTATCAACTGTGTTGTAT
TCAAAAAACAAGCAGAAAATGTCAAAAACTATTTAAGTAAAGGTAGTTTAGCCGGTGTTGATGGTCGCCTACAATCACGT
AGTTACGAAAATCAAGAGGGGCGACGTGTGTATGTAACAGAAGTAATTTGTGATAGCGTGCAGTTTTTAGAGCCTAAAAG
TAACAATCAGTCTAACAATCAACCGCAGCAACAAAGAGGTCAAGCACCTGCGCAAGATAATCCTTTCGCTATCGCAAACG
GTCCGATTGATATCGATGATGACGATATGCCCTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
56.395 |
100 |
0.669 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.176 |
100 |
0.6 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
73.103 |
0.434 |
| ssb | Glaesserella parasuis strain SC1401 |
33.146 |
100 |
0.407 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
39.31 |
100 |
0.393 |
| ssb | Vibrio cholerae strain A1552 |
31.214 |
100 |
0.372 |