Detailed information NTG0796974

Bioinformatically predicted

Overview

• Name: comGF
• Type: Machinery gene
• Locus tag: PYW37_RS11970
• Genome accession: NZ_CP118969
• Coordinates: 2339788..2340234 (-)
• Length: 148 a.a.
• NCBI ID: WP_032943612.1
• Uniprot ID: A0A0B8QKK0
• Organism: Lactococcus lactis strain DSM 20481
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2334788..2345234

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
PYW37_RS11935	-	2334897..2335274 (-)	378	WP_003129983.1	pyridoxamine 5'-phosphate oxidase family protein	-
PYW37_RS11940	-	2335479..2336345 (+)	867	WP_025017140.1	RluA family pseudouridine synthase	-
PYW37_RS11945	-	2336383..2337192 (-)	810	WP_014570791.1	metal ABC transporter permease	-
PYW37_RS11950	-	2337185..2337922 (-)	738	WP_012898617.1	metal ABC transporter ATP-binding protein	-
PYW37_RS11955	-	2338099..2338941 (-)	843	WP_015427160.1	metal ABC transporter substrate-binding protein	-
PYW37_RS11960	-	2338938..2339375 (-)	438	WP_003129992.1	zinc-dependent MarR family transcriptional regulator	-
PYW37_RS11965	comGG	2339465..2339749 (-)	285	WP_025017139.1	competence type IV pilus minor pilin ComGG	Machinery gene
PYW37_RS11970	comGF	2339788..2340234 (-)	447	WP_032943612.1	competence type IV pilus minor pilin ComGF	Machinery gene
PYW37_RS11975	comGE	2340197..2340493 (-)	297	WP_010906316.1	competence type IV pilus minor pilin ComGE	Machinery gene
PYW37_RS11980	comGD	2340465..2340881 (-)	417	WP_025017137.1	competence type IV pilus minor pilin ComGD	Machinery gene
PYW37_RS11985	comGC	2340856..2341179 (-)	324	WP_032943614.1	competence type IV pilus major pilin ComGC	Machinery gene
PYW37_RS11990	comGB	2341253..2342272 (-)	1020	WP_044009599.1	competence type IV pilus assembly protein ComGB	Machinery gene
PYW37_RS11995	comGA	2342220..2343158 (-)	939	WP_031561106.1	competence type IV pilus ATPase ComGA	Machinery gene

Sequence

Protein

• Length: 148 a.a.
• Molecular weight: 17080.89 Da
• Isoelectric Point: 8.6780

>NTDB_id=796974 PYW37_RS11970 WP_032943612.1 2339788..2340234(-) (comGF) [Lactococcus lactis strain DSM 20481]
MERKLCDLNFKVKAFTLLECLVALLAISGSVLVISGLTKMLKEQVAISQSDSIKDWQIFCQPMRFELSGTKLDRVEQNFL
YVTKDKKLRFGFMSDDFRKTDDKGQGYQPMLYDIKAAKIQATKNLITIRIDFNQGGERTFIYQFPEDT

Nucleotide

• Length: 447 bp

>NTDB_id=796974 PYW37_RS11970 WP_032943612.1 2339788..2340234(-) (comGF) [Lactococcus lactis strain DSM 20481]
ATGGAAAGGAAATTATGCGACTTGAACTTCAAAGTTAAAGCATTTACCTTGTTGGAGTGTTTGGTGGCACTTCTTGCAAT
TTCTGGTTCAGTCCTTGTCATCTCAGGTTTAACAAAGATGTTGAAAGAACAAGTGGCGATTAGTCAAAGTGATAGCATAA
AAGATTGGCAAATTTTCTGTCAGCCAATGCGTTTTGAACTCTCAGGAACAAAATTAGATAGGGTAGAACAGAATTTTCTG
TATGTAACTAAAGATAAAAAACTAAGGTTTGGTTTTATGAGTGATGATTTCCGGAAGACTGATGACAAAGGTCAGGGTTA
TCAGCCAATGCTTTATGATATAAAAGCGGCTAAGATTCAAGCTACTAAAAATTTAATAACCATAAGAATTGATTTTAATC
AAGGAGGTGAAAGAACATTTATTTATCAATTTCCAGAAGATACGTAA

Domains

Predicted by InterproScan.

• Putative Competence protein ComGF (ComGF) (48-137)

3D structure

• AlphaFold DB: A0A0B8QKK0

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGF	Lactococcus lactis subsp. cremoris KW2	75.54	93.919	0.709
comYF	Streptococcus mutans UA140	47.518	95.27	0.453
comYF	Streptococcus mutans UA159	46.809	95.27	0.446
comGF/cglF	Streptococcus mitis SK321	42.336	92.568	0.392
comGF/cglF	Streptococcus mitis NCTC 12261	40.876	92.568	0.378
comGF/cglF	Streptococcus pneumoniae Rx1	39.716	95.27	0.378
comGF/cglF	Streptococcus pneumoniae D39	39.716	95.27	0.378
comGF/cglF	Streptococcus pneumoniae R6	39.716	95.27	0.378
comGF/cglF	Streptococcus pneumoniae TIGR4	39.716	95.27	0.378