Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   PDI58_RS05145 Genome accession   NZ_CP115474
Coordinates   1001010..1001480 (-) Length   156 a.a.
NCBI ID   WP_000934768.1    Uniprot ID   -
Organism   Staphylococcus aureus strain AF4005     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 968851..1017084 1001010..1001480 within 0


Gene organization within MGE regions


Location: 968851..1017084
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PDI58_RS04900 (PDI58_04900) - 968851..969036 (-) 186 WP_001286805.1 hypothetical protein -
  PDI58_RS04905 (PDI58_04905) - 969038..969148 (-) 111 WP_000139423.1 hypothetical protein -
  PDI58_RS04910 (PDI58_04910) - 969219..969371 (-) 153 WP_001788502.1 hypothetical protein -
  PDI58_RS04915 (PDI58_04915) - 969613..971058 (-) 1446 WP_001148142.1 SH3 domain-containing protein -
  PDI58_RS04920 (PDI58_04920) - 971039..971476 (-) 438 WP_000354135.1 phage holin -
  PDI58_RS04925 (PDI58_04925) - 971533..971928 (-) 396 WP_000398882.1 hypothetical protein -
  PDI58_RS04930 (PDI58_04930) - 971934..973106 (-) 1173 WP_000276624.1 BppU family phage baseplate upper protein -
  PDI58_RS04935 (PDI58_04935) - 973119..975017 (-) 1899 WP_290267498.1 glucosaminidase domain-containing protein -
  PDI58_RS04940 (PDI58_04940) - 975154..975453 (-) 300 WP_000466778.1 DUF2951 domain-containing protein -
  PDI58_RS04945 (PDI58_04945) - 975493..975666 (-) 174 WP_000782200.1 XkdX family protein -
  PDI58_RS04950 (PDI58_04950) - 975670..976047 (-) 378 WP_000705896.1 DUF2977 domain-containing protein -
  PDI58_RS04955 (PDI58_04955) - 976047..977870 (-) 1824 WP_290267500.1 BppU family phage baseplate upper protein -
  PDI58_RS04960 (PDI58_04960) - 977870..979780 (-) 1911 WP_000066423.1 hypothetical protein -
  PDI58_RS04965 (PDI58_04965) - 979795..981696 (-) 1902 WP_001599106.1 SGNH/GDSL hydrolase family protein -
  PDI58_RS04970 (PDI58_04970) - 981705..982652 (-) 948 WP_290267504.1 phage tail family protein -
  PDI58_RS04975 (PDI58_04975) - 982665..986129 (-) 3465 WP_000141485.1 hypothetical protein -
  PDI58_RS04980 (PDI58_04980) - 986146..986490 (-) 345 WP_000105584.1 hypothetical protein -
  PDI58_RS04985 (PDI58_04985) - 986520..986885 (-) 366 WP_001100163.1 tail assembly chaperone -
  PDI58_RS04990 (PDI58_04990) - 986947..987528 (-) 582 WP_000002583.1 phage major tail protein, TP901-1 family -
  PDI58_RS04995 (PDI58_04995) - 987547..987930 (-) 384 WP_000188643.1 hypothetical protein -
  PDI58_RS05000 (PDI58_05000) - 987942..988289 (-) 348 WP_001017815.1 HK97-gp10 family putative phage morphogenesis protein -
  PDI58_RS05005 (PDI58_05005) - 988289..988591 (-) 303 WP_001268312.1 hypothetical protein -
  PDI58_RS05010 (PDI58_05010) - 988588..988920 (-) 333 WP_000208960.1 phage head-tail connector protein -
  PDI58_RS05015 (PDI58_05015) - 988929..989216 (-) 288 WP_001114086.1 hypothetical protein -
  PDI58_RS05020 (PDI58_05020) - 989238..990212 (-) 975 WP_000438511.1 phage major capsid protein -
  PDI58_RS05025 (PDI58_05025) - 990226..990846 (-) 621 WP_000392144.1 DUF4355 domain-containing protein -
  PDI58_RS05030 (PDI58_05030) - 990834..990927 (-) 94 Protein_965 hypothetical protein -
  PDI58_RS05035 (PDI58_05035) - 990955..991125 (-) 171 WP_000072202.1 hypothetical protein -
  PDI58_RS05040 (PDI58_05040) - 991198..992193 (-) 996 WP_001668926.1 minor capsid protein -
  PDI58_RS05045 (PDI58_05045) - 992200..993738 (-) 1539 WP_031766723.1 phage portal protein -
  PDI58_RS05050 (PDI58_05050) - 993749..995026 (-) 1278 WP_000169945.1 PBSX family phage terminase large subunit -
  PDI58_RS05055 (PDI58_05055) - 995013..995453 (-) 441 WP_001003272.1 terminase small subunit -
  PDI58_RS05060 (PDI58_05060) - 995640..996062 (-) 423 WP_000162696.1 RinA family phage transcriptional activator -
  PDI58_RS05065 (PDI58_05065) - 996086..996232 (-) 147 WP_000990001.1 hypothetical protein -
  PDI58_RS05070 (PDI58_05070) - 996233..996406 (-) 174 WP_000595244.1 transcriptional activator RinB -
  PDI58_RS05075 (PDI58_05075) - 996406..996792 (-) 387 WP_001555739.1 hypothetical protein -
  PDI58_RS05080 (PDI58_05080) - 996782..997018 (-) 237 WP_000608273.1 hypothetical protein -
  PDI58_RS05085 (PDI58_05085) - 997011..997214 (-) 204 WP_001072795.1 hypothetical protein -
  PDI58_RS05090 (PDI58_05090) - 997211..997405 (-) 195 WP_000132920.1 hypothetical protein -
  PDI58_RS05095 (PDI58_05095) - 997402..997608 (-) 207 WP_000195779.1 DUF1381 domain-containing protein -
  PDI58_RS05100 (PDI58_05100) - 997625..997798 (-) 174 WP_001209219.1 hypothetical protein -
  PDI58_RS05105 (PDI58_05105) - 997835..998371 (-) 537 WP_000185704.1 dUTPase -
  PDI58_RS05110 (PDI58_05110) - 998364..998546 (-) 183 WP_000028425.1 hypothetical protein -
  PDI58_RS05115 (PDI58_05115) - 998536..998787 (-) 252 WP_001065074.1 DUF1024 family protein -
  PDI58_RS05120 (PDI58_05120) - 998828..999070 (-) 243 WP_000131382.1 SAV1978 family virulence-associated passenger protein -
  PDI58_RS05125 (PDI58_05125) - 999074..999442 (-) 369 WP_001140280.1 SA1788 family PVL leukocidin-associated protein -
  PDI58_RS05130 (PDI58_05130) - 999455..999859 (-) 405 WP_000401971.1 RusA family crossover junction endodeoxyribonuclease -
  PDI58_RS05135 (PDI58_05135) - 999868..1000086 (-) 219 WP_000338528.1 hypothetical protein -
  PDI58_RS05140 (PDI58_05140) - 1000093..1000980 (-) 888 WP_000148306.1 DnaD domain protein -
  PDI58_RS05145 (PDI58_05145) ssbA 1001010..1001480 (-) 471 WP_000934768.1 single-stranded DNA-binding protein Machinery gene
  PDI58_RS05150 (PDI58_05150) - 1001481..1002098 (-) 618 WP_071890040.1 MBL fold metallo-hydrolase -
  PDI58_RS05155 (PDI58_05155) - 1002179..1003099 (-) 921 WP_000138475.1 recombinase RecT -
  PDI58_RS05160 (PDI58_05160) - 1003101..1005044 (-) 1944 WP_000700555.1 AAA family ATPase -
  PDI58_RS05165 (PDI58_05165) - 1005053..1005316 (-) 264 WP_001205732.1 hypothetical protein -
  PDI58_RS05170 (PDI58_05170) - 1005325..1005585 (-) 261 WP_000291075.1 DUF1108 family protein -
  PDI58_RS05175 (PDI58_05175) - 1005679..1005999 (-) 321 WP_000219666.1 hypothetical protein -
  PDI58_RS05180 (PDI58_05180) - 1006000..1006167 (-) 168 WP_001285957.1 DUF1270 domain-containing protein -
  PDI58_RS05185 (PDI58_05185) - 1006160..1006288 (-) 129 WP_001559112.1 hypothetical protein -
  PDI58_RS05190 (PDI58_05190) - 1006347..1006577 (+) 231 WP_000395457.1 hypothetical protein -
  PDI58_RS05195 (PDI58_05195) - 1006552..1006728 (-) 177 WP_001094937.1 hypothetical protein -
  PDI58_RS05200 (PDI58_05200) - 1006753..1007493 (-) 741 WP_086114972.1 phage antirepressor KilAC domain-containing protein -
  PDI58_RS05205 (PDI58_05205) - 1007495..1007680 (-) 186 WP_000933365.1 helix-turn-helix transcriptional regulator -
  PDI58_RS05210 (PDI58_05210) - 1008131..1008367 (+) 237 WP_216798501.1 hypothetical protein -
  PDI58_RS05215 (PDI58_05215) - 1008360..1008521 (-) 162 WP_001153175.1 hypothetical protein -
  PDI58_RS05220 (PDI58_05220) - 1008536..1008790 (-) 255 WP_001106626.1 helix-turn-helix transcriptional regulator -
  PDI58_RS05225 (PDI58_05225) - 1008980..1009618 (+) 639 WP_000874708.1 S24 family peptidase -
  PDI58_RS05230 (PDI58_05230) - 1009650..1010330 (+) 681 WP_000392109.1 type II toxin-antitoxin system PemK/MazF family toxin -
  PDI58_RS05235 (PDI58_05235) - 1010537..1011922 (+) 1386 WP_000861313.1 recombinase family protein -
  PDI58_RS05240 (PDI58_05240) rpmF 1012039..1012212 (-) 174 WP_000290472.1 50S ribosomal protein L32 -
  PDI58_RS05245 (PDI58_05245) - 1012292..1012849 (-) 558 WP_000872158.1 DUF177 domain-containing protein -
  PDI58_RS05250 (PDI58_05250) - 1012976..1014115 (+) 1140 WP_000843611.1 nucleotidyltransferase -
  PDI58_RS05255 (PDI58_05255) coaD 1014177..1014659 (-) 483 WP_000401377.1 pantetheine-phosphate adenylyltransferase -
  PDI58_RS05260 (PDI58_05260) rsmD 1014661..1015203 (-) 543 WP_001263796.1 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD -
  PDI58_RS05265 (PDI58_05265) - 1015273..1015662 (+) 390 WP_000814565.1 hypothetical protein -
  PDI58_RS05270 (PDI58_05270) - 1015665..1015919 (-) 255 WP_001049150.1 YlbG family protein -
  PDI58_RS05275 (PDI58_05275) - 1016158..1017084 (+) 927 WP_000757575.1 glycerophosphodiester phosphodiesterase -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17747.64 Da        Isoelectric Point: 4.9816

>NTDB_id=772310 PDI58_RS05145 WP_000934768.1 1001010..1001480(-) (ssbA) [Staphylococcus aureus strain AF4005]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYKQQAQQSRGQSQYPYNKPVKDNPFANANDPIEIDDDDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=772310 PDI58_RS05145 WP_000934768.1 1001010..1001480(-) (ssbA) [Staphylococcus aureus strain AF4005]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACAAACAACAAGCGCAACAATCACGTGGACAGTCTCAATATCCATATAACAAAC
CAGTAAAAGATAATCCGTTCGCAAATGCGAATGATCCTATTGAAATAGATGACGATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.367

100

0.628

  ssb Latilactobacillus sakei subsp. sakei 23K

51.765

100

0.564

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Neisseria meningitidis MC58

33.526

100

0.372

  ssb Neisseria gonorrhoeae MS11

33.526

100

0.372

  ssb Glaesserella parasuis strain SC1401

32.203

100

0.365