Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | OZX59_RS00010 | Genome accession | NZ_CP113943 |
| Coordinates | 809..1264 (+) | Length | 151 a.a. |
| NCBI ID | WP_277126101.1 | Uniprot ID | - |
| Organism | Lactobacillus sp. ESL0681 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 5..29529 | 809..1264 | within | 0 |
Gene organization within MGE regions
Location: 5..29529
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OZX59_RS00005 (OZX59_00005) | - | 5..808 (+) | 804 | WP_277126100.1 | DnaA/Hda family protein | - |
| OZX59_RS00010 (OZX59_00010) | ssb | 809..1264 (+) | 456 | WP_277126101.1 | single-stranded DNA-binding protein | Machinery gene |
| OZX59_RS00015 (OZX59_00015) | - | 1278..1565 (+) | 288 | WP_277126102.1 | DUF6275 family protein | - |
| OZX59_RS00020 (OZX59_00020) | - | 1762..2232 (+) | 471 | WP_277126103.1 | hypothetical protein | - |
| OZX59_RS00025 (OZX59_00025) | - | 2225..2605 (+) | 381 | WP_277127019.1 | VRR-NUC domain-containing protein | - |
| OZX59_RS00030 (OZX59_00030) | - | 2595..2792 (+) | 198 | WP_277126104.1 | hypothetical protein | - |
| OZX59_RS00035 (OZX59_00035) | - | 2773..3261 (+) | 489 | WP_277126105.1 | hypothetical protein | - |
| OZX59_RS00040 (OZX59_00040) | - | 3278..3733 (+) | 456 | WP_277126106.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| OZX59_RS00045 (OZX59_00045) | - | 3777..4052 (-) | 276 | WP_277126107.1 | type II toxin-antitoxin system YafQ family toxin | - |
| OZX59_RS00050 (OZX59_00050) | - | 4039..4317 (-) | 279 | WP_277126108.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
| OZX59_RS00055 (OZX59_00055) | - | 4718..5626 (+) | 909 | WP_277126109.1 | hypothetical protein | - |
| OZX59_RS00060 (OZX59_00060) | - | 5672..5980 (+) | 309 | WP_277126110.1 | hypothetical protein | - |
| OZX59_RS00065 (OZX59_00065) | - | 6034..6468 (+) | 435 | WP_277126111.1 | terminase small subunit | - |
| OZX59_RS00070 (OZX59_00070) | - | 6461..7708 (+) | 1248 | WP_277126112.1 | PBSX family phage terminase large subunit | - |
| OZX59_RS00075 (OZX59_00075) | - | 7699..9123 (+) | 1425 | WP_277126113.1 | phage portal protein | - |
| OZX59_RS00080 (OZX59_00080) | - | 9101..10510 (+) | 1410 | WP_277126114.1 | minor capsid protein | - |
| OZX59_RS00085 (OZX59_00085) | - | 10522..10731 (+) | 210 | WP_277126115.1 | hypothetical protein | - |
| OZX59_RS00090 (OZX59_00090) | - | 10731..11060 (+) | 330 | WP_277126116.1 | YjcQ family protein | - |
| OZX59_RS00095 (OZX59_00095) | - | 11171..11734 (+) | 564 | WP_277126117.1 | phage scaffolding protein | - |
| OZX59_RS00100 (OZX59_00100) | - | 11721..12716 (+) | 996 | WP_277126118.1 | capsid protein | - |
| OZX59_RS00105 (OZX59_00105) | - | 12725..13111 (+) | 387 | WP_277126119.1 | hypothetical protein | - |
| OZX59_RS00110 (OZX59_00110) | - | 13108..13470 (+) | 363 | WP_277126120.1 | hypothetical protein | - |
| OZX59_RS00115 (OZX59_00115) | - | 13467..13871 (+) | 405 | WP_277126121.1 | HK97 gp10 family phage protein | - |
| OZX59_RS00120 (OZX59_00120) | - | 13868..14278 (+) | 411 | WP_277126122.1 | DUF6838 family protein | - |
| OZX59_RS00125 (OZX59_00125) | - | 14259..14444 (+) | 186 | WP_277126123.1 | hypothetical protein | - |
| OZX59_RS00130 (OZX59_00130) | - | 14445..15809 (+) | 1365 | WP_277126124.1 | phage tail sheath family protein | - |
| OZX59_RS00135 (OZX59_00135) | - | 15823..16299 (+) | 477 | WP_277126125.1 | phage tail tube protein | - |
| OZX59_RS00140 (OZX59_00140) | - | 16311..16730 (+) | 420 | WP_277126126.1 | hypothetical protein | - |
| OZX59_RS00145 (OZX59_00145) | - | 16950..20168 (+) | 3219 | WP_277126127.1 | tape measure protein | - |
| OZX59_RS00150 (OZX59_00150) | - | 20182..20925 (+) | 744 | WP_277126128.1 | hypothetical protein | - |
| OZX59_RS00155 (OZX59_00155) | - | 20922..21947 (+) | 1026 | WP_277126129.1 | late control protein D | - |
| OZX59_RS00160 (OZX59_00160) | - | 21920..22300 (+) | 381 | WP_277126130.1 | DUF2577 domain-containing protein | - |
| OZX59_RS00165 (OZX59_00165) | - | 22657..23139 (+) | 483 | WP_348636459.1 | DUF2634 domain-containing protein | - |
| OZX59_RS00170 (OZX59_00170) | - | 23126..24274 (+) | 1149 | WP_277126131.1 | baseplate J/gp47 family protein | - |
| OZX59_RS00175 (OZX59_00175) | - | 24267..24821 (+) | 555 | WP_277126132.1 | putative phage tail protein | - |
| OZX59_RS00180 (OZX59_00180) | - | 24834..26825 (+) | 1992 | WP_277126133.1 | hypothetical protein | - |
| OZX59_RS00185 (OZX59_00185) | - | 26886..27008 (+) | 123 | WP_277126134.1 | hypothetical protein | - |
| OZX59_RS00190 (OZX59_00190) | - | 27127..27390 (+) | 264 | WP_277126135.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
| OZX59_RS00195 (OZX59_00195) | - | 27383..27649 (+) | 267 | WP_277126136.1 | Txe/YoeB family addiction module toxin | - |
| OZX59_RS00200 (OZX59_00200) | - | 27711..28043 (+) | 333 | WP_277126137.1 | hypothetical protein | - |
| OZX59_RS00205 (OZX59_00205) | - | 28056..28466 (+) | 411 | WP_277126138.1 | hypothetical protein | - |
| OZX59_RS00210 (OZX59_00210) | - | 28459..29529 (+) | 1071 | WP_277126139.1 | GH25 family lysozyme | - |
Sequence
Protein
Download Length: 151 a.a. Molecular weight: 17041.79 Da Isoelectric Point: 4.7501
>NTDB_id=763667 OZX59_RS00010 WP_277126101.1 809..1264(+) (ssb) [Lactobacillus sp. ESL0681]
MINRTVLVGRLTRDPELRTTQSGLSVLSFTLAVERTFKNKDGSRDADFIQCVAWKKTAEIINQYCHKGSMIGVDGRIQTR
NYEDKNGQRVYVTEIVADQIALLDPKDSNQGQQGSYQQNNSRYNSNQNQIETDPFTGSSDTIDISDDDLPF
MINRTVLVGRLTRDPELRTTQSGLSVLSFTLAVERTFKNKDGSRDADFIQCVAWKKTAEIINQYCHKGSMIGVDGRIQTR
NYEDKNGQRVYVTEIVADQIALLDPKDSNQGQQGSYQQNNSRYNSNQNQIETDPFTGSSDTIDISDDDLPF
Nucleotide
Download Length: 456 bp
>NTDB_id=763667 OZX59_RS00010 WP_277126101.1 809..1264(+) (ssb) [Lactobacillus sp. ESL0681]
ATGATTAATAGAACGGTATTAGTAGGACGGCTCACACGTGACCCAGAGCTAAGGACAACGCAAAGCGGTTTGTCGGTGCT
GTCGTTTACTTTAGCAGTTGAGCGAACATTTAAAAATAAAGATGGCTCACGTGACGCTGACTTTATTCAGTGTGTTGCTT
GGAAGAAAACGGCGGAGATAATTAATCAATATTGCCACAAAGGTTCAATGATTGGTGTAGATGGTCGCATTCAAACTAGA
AATTATGAAGATAAGAATGGTCAGCGAGTTTACGTTACTGAAATTGTAGCAGATCAGATTGCACTACTTGATCCAAAGGA
TAGCAATCAAGGCCAGCAAGGTAGCTATCAACAAAACAACAGCAGATATAACAGTAATCAAAATCAAATTGAAACAGATC
CATTTACTGGTAGTAGCGACACAATCGATATTTCAGATGACGACTTACCGTTTTAG
ATGATTAATAGAACGGTATTAGTAGGACGGCTCACACGTGACCCAGAGCTAAGGACAACGCAAAGCGGTTTGTCGGTGCT
GTCGTTTACTTTAGCAGTTGAGCGAACATTTAAAAATAAAGATGGCTCACGTGACGCTGACTTTATTCAGTGTGTTGCTT
GGAAGAAAACGGCGGAGATAATTAATCAATATTGCCACAAAGGTTCAATGATTGGTGTAGATGGTCGCATTCAAACTAGA
AATTATGAAGATAAGAATGGTCAGCGAGTTTACGTTACTGAAATTGTAGCAGATCAGATTGCACTACTTGATCCAAAGGA
TAGCAATCAAGGCCAGCAAGGTAGCTATCAACAAAACAACAGCAGATATAACAGTAATCAAAATCAAATTGAAACAGATC
CATTTACTGGTAGTAGCGACACAATCGATATTTCAGATGACGACTTACCGTTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
48.837 |
100 |
0.556 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
48.256 |
100 |
0.55 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
41.176 |
100 |
0.417 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
54.717 |
70.199 |
0.384 |
| ssbA | Streptococcus mutans UA159 |
36.424 |
100 |
0.364 |
| ssb | Glaesserella parasuis strain SC1401 |
31.073 |
100 |
0.364 |