Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | ORU23_RS10910 | Genome accession | NZ_CP113236 |
| Coordinates | 2252362..2252814 (-) | Length | 150 a.a. |
| NCBI ID | WP_078801814.1 | Uniprot ID | - |
| Organism | Pasteurella multocida strain PF8 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2246345..2294505 | 2252362..2252814 | within | 0 |
Gene organization within MGE regions
Location: 2246345..2294505
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORU23_RS10885 (ORU23_10885) | - | 2246354..2246728 (+) | 375 | WP_225529671.1 | LysR family transcriptional regulator | - |
| ORU23_RS10890 (ORU23_10890) | - | 2246974..2247384 (-) | 411 | WP_010907416.1 | hypothetical protein | - |
| ORU23_RS10895 (ORU23_10895) | - | 2247386..2249422 (-) | 2037 | WP_010907417.1 | integrase | - |
| ORU23_RS10900 (ORU23_10900) | - | 2249425..2250945 (-) | 1521 | WP_010907418.1 | site-specific integrase | - |
| ORU23_RS10905 (ORU23_10905) | - | 2250932..2252212 (-) | 1281 | WP_016533798.1 | site-specific integrase | - |
| ORU23_RS10910 (ORU23_10910) | ssb | 2252362..2252814 (-) | 453 | WP_078801814.1 | single-stranded DNA-binding protein | Machinery gene |
| ORU23_RS10915 (ORU23_10915) | - | 2252814..2253473 (-) | 660 | WP_266212962.1 | translocation protein TolB precursor | - |
| ORU23_RS10920 (ORU23_10920) | - | 2253460..2254413 (-) | 954 | WP_014391451.1 | recombinase RecT | - |
| ORU23_RS10925 (ORU23_10925) | - | 2254415..2254702 (-) | 288 | WP_014391452.1 | hypothetical protein | - |
| ORU23_RS10930 (ORU23_10930) | - | 2254715..2254951 (-) | 237 | WP_075271355.1 | hypothetical protein | - |
| ORU23_RS10935 (ORU23_10935) | - | 2254923..2255222 (-) | 300 | WP_078802174.1 | hypothetical protein | - |
| ORU23_RS10940 (ORU23_10940) | - | 2255370..2255600 (+) | 231 | WP_223251317.1 | hypothetical protein | - |
| ORU23_RS10945 (ORU23_10945) | - | 2255662..2256420 (-) | 759 | WP_323135003.1 | KilA-N domain-containing protein | - |
| ORU23_RS10950 (ORU23_10950) | - | 2256559..2256936 (-) | 378 | Protein_2114 | Bro-N domain-containing protein | - |
| ORU23_RS10955 (ORU23_10955) | - | 2257300..2257494 (+) | 195 | WP_014391459.1 | hypothetical protein | - |
| ORU23_RS10960 (ORU23_10960) | - | 2257475..2257645 (-) | 171 | WP_225529669.1 | hypothetical protein | - |
| ORU23_RS10965 (ORU23_10965) | - | 2257658..2257888 (-) | 231 | WP_078737821.1 | hypothetical protein | - |
| ORU23_RS10970 (ORU23_10970) | - | 2258130..2258339 (-) | 210 | WP_005756656.1 | hypothetical protein | - |
| ORU23_RS10975 (ORU23_10975) | - | 2258352..2258519 (+) | 168 | WP_005756653.1 | YegP family protein | - |
| ORU23_RS10980 (ORU23_10980) | - | 2258825..2259139 (+) | 315 | WP_078819687.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| ORU23_RS10985 (ORU23_10985) | - | 2259136..2259426 (+) | 291 | WP_078819686.1 | addiction module antidote protein | - |
| ORU23_RS10990 (ORU23_10990) | - | 2259452..2259856 (-) | 405 | WP_146024473.1 | hypothetical protein | - |
| ORU23_RS10995 (ORU23_10995) | - | 2259886..2261730 (-) | 1845 | WP_071523830.1 | DEAD/DEAH box helicase | - |
| ORU23_RS11000 (ORU23_11000) | - | 2261941..2262624 (-) | 684 | WP_099821842.1 | helix-turn-helix transcriptional regulator | - |
| ORU23_RS11005 (ORU23_11005) | - | 2262749..2262949 (+) | 201 | WP_099821841.1 | YdaS family helix-turn-helix protein | - |
| ORU23_RS11010 (ORU23_11010) | - | 2262998..2263447 (+) | 450 | WP_099821840.1 | YmfL family putative regulatory protein | - |
| ORU23_RS11015 (ORU23_11015) | - | 2263505..2264188 (+) | 684 | WP_014390721.1 | phage antirepressor KilAC domain-containing protein | - |
| ORU23_RS11020 (ORU23_11020) | - | 2264185..2264400 (+) | 216 | WP_075271368.1 | hypothetical protein | - |
| ORU23_RS11025 (ORU23_11025) | - | 2264397..2265233 (+) | 837 | WP_225529668.1 | helix-turn-helix domain-containing protein | - |
| ORU23_RS11030 (ORU23_11030) | - | 2265233..2265922 (+) | 690 | WP_225529667.1 | replication protein P | - |
| ORU23_RS11035 (ORU23_11035) | - | 2265926..2266462 (+) | 537 | WP_178384709.1 | phage N-6-adenine-methyltransferase | - |
| ORU23_RS11040 (ORU23_11040) | - | 2266452..2266910 (+) | 459 | WP_014391471.1 | recombination protein NinB | - |
| ORU23_RS11045 (ORU23_11045) | - | 2266984..2267199 (+) | 216 | WP_225529666.1 | hypothetical protein | - |
| ORU23_RS11050 (ORU23_11050) | - | 2267192..2267794 (+) | 603 | WP_170376544.1 | recombination protein NinG | - |
| ORU23_RS11055 (ORU23_11055) | - | 2267795..2268256 (+) | 462 | WP_225529665.1 | antiterminator Q family protein | - |
| ORU23_RS11060 (ORU23_11060) | - | 2268382..2268945 (-) | 564 | WP_014667793.1 | hypothetical protein | - |
| ORU23_RS11065 (ORU23_11065) | - | 2269063..2269320 (+) | 258 | WP_081376958.1 | HP1 family phage holin | - |
| ORU23_RS11070 (ORU23_11070) | - | 2269317..2269847 (+) | 531 | WP_069915984.1 | lysozyme | - |
| ORU23_RS11075 (ORU23_11075) | - | 2269820..2270143 (+) | 324 | WP_078801840.1 | DUF2570 family protein | - |
| ORU23_RS11080 (ORU23_11080) | - | 2270353..2270721 (-) | 369 | WP_014391478.1 | helix-turn-helix domain-containing protein | - |
| ORU23_RS11085 (ORU23_11085) | - | 2270757..2271017 (-) | 261 | WP_005720780.1 | type II toxin-antitoxin system RelE family toxin | - |
| ORU23_RS11090 (ORU23_11090) | - | 2271307..2271780 (+) | 474 | WP_014391479.1 | DUF1441 family protein | - |
| ORU23_RS11095 (ORU23_11095) | - | 2271784..2273892 (+) | 2109 | WP_014391480.1 | phage terminase large subunit family protein | - |
| ORU23_RS11100 (ORU23_11100) | - | 2273889..2274110 (+) | 222 | WP_014391481.1 | hypothetical protein | - |
| ORU23_RS11105 (ORU23_11105) | - | 2274107..2275645 (+) | 1539 | WP_016533224.1 | phage portal protein | - |
| ORU23_RS11110 (ORU23_11110) | - | 2275581..2277590 (+) | 2010 | WP_078819665.1 | ClpP-like prohead protease/major capsid protein fusion protein | - |
| ORU23_RS11115 (ORU23_11115) | - | 2277663..2277989 (+) | 327 | WP_016570083.1 | DUF2190 family protein | - |
| ORU23_RS11120 (ORU23_11120) | - | 2277982..2278275 (+) | 294 | WP_014391484.1 | hypothetical protein | - |
| ORU23_RS11125 (ORU23_11125) | - | 2278275..2278826 (+) | 552 | WP_014391485.1 | phage tail protein | - |
| ORU23_RS11130 (ORU23_11130) | gpU | 2278823..2279230 (+) | 408 | WP_014391486.1 | phage tail terminator protein | - |
| ORU23_RS11135 (ORU23_11135) | - | 2279227..2279733 (+) | 507 | WP_078819785.1 | phage tail tube protein | - |
| ORU23_RS11140 (ORU23_11140) | - | 2279739..2280128 (+) | 390 | WP_016533230.1 | phage minor tail protein G | - |
| ORU23_RS11145 (ORU23_11145) | - | 2280149..2280451 (+) | 303 | WP_225529681.1 | phage tail assembly protein T | - |
| ORU23_RS11150 (ORU23_11150) | - | 2280438..2282831 (+) | 2394 | WP_225529664.1 | phage tail length tape measure family protein | - |
| ORU23_RS11155 (ORU23_11155) | - | 2282828..2283178 (+) | 351 | WP_005719622.1 | phage tail protein | - |
| ORU23_RS11160 (ORU23_11160) | - | 2283250..2283816 (+) | 567 | WP_078819667.1 | hypothetical protein | - |
| ORU23_RS11165 (ORU23_11165) | - | 2283970..2284674 (+) | 705 | WP_080166595.1 | phage minor tail protein L | - |
| ORU23_RS11170 (ORU23_11170) | - | 2284679..2285422 (+) | 744 | WP_078801829.1 | C40 family peptidase | - |
| ORU23_RS11175 (ORU23_11175) | - | 2285365..2285985 (+) | 621 | WP_014667799.1 | tail assembly protein | - |
| ORU23_RS11180 (ORU23_11180) | - | 2285989..2291883 (+) | 5895 | WP_267929185.1 | phage tail protein | - |
| ORU23_RS11185 (ORU23_11185) | - | 2291931..2292254 (+) | 324 | WP_014667801.1 | hypothetical protein | - |
| ORU23_RS11190 (ORU23_11190) | - | 2292680..2293516 (+) | 837 | WP_014390712.1 | KilA-N domain-containing protein | - |
| ORU23_RS11195 (ORU23_11195) | - | 2293819..2294505 (+) | 687 | WP_225529662.1 | KilA-N domain-containing protein | - |
Sequence
Protein
Download Length: 150 a.a. Molecular weight: 17107.99 Da Isoelectric Point: 7.9707
>NTDB_id=761079 ORU23_RS10910 WP_078801814.1 2252362..2252814(-) (ssb) [Pasteurella multocida strain PF8]
MAGVNRVIILGNLGSDPEIRTMPNGDPVAKISVATSESWIDKNTNERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
KLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQQQQAQAPQNNAYANAKAGKPVQQQAYNFEEDNIPF
MAGVNRVIILGNLGSDPEIRTMPNGDPVAKISVATSESWIDKNTNERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
KLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQQQQAQAPQNNAYANAKAGKPVQQQAYNFEEDNIPF
Nucleotide
Download Length: 453 bp
>NTDB_id=761079 ORU23_RS10910 WP_078801814.1 2252362..2252814(-) (ssb) [Pasteurella multocida strain PF8]
ATGGCTGGGGTTAATCGTGTAATTATTTTAGGAAATTTAGGAAGCGATCCTGAAATCCGCACAATGCCAAATGGCGACCC
TGTGGCAAAAATCAGTGTGGCCACAAGTGAAAGCTGGATTGATAAAAACACAAACGAACGAAAAACACAAACTGAATGGC
ATTCTATCGTGTTCTATCGTCGCCAAGCAGAAATTTGCGGGCAGTATTTGAAGAAAGGCTCGAAAGTTTATGTGGAAGGT
AAGCTCAGAACACGCAAATGGCAAGATCAAAATGGTCAAGACCGCTACACCACAGAGATTCAAGGCGACGTATTACAAAT
GCTAGACAGTCGCCAAGATTCACAGCAACAGCAAGCACAGGCACCACAAAATAATGCTTATGCGAATGCGAAAGCTGGAA
AGCCTGTACAGCAACAAGCATATAACTTTGAAGAGGATAATATCCCATTCTGA
ATGGCTGGGGTTAATCGTGTAATTATTTTAGGAAATTTAGGAAGCGATCCTGAAATCCGCACAATGCCAAATGGCGACCC
TGTGGCAAAAATCAGTGTGGCCACAAGTGAAAGCTGGATTGATAAAAACACAAACGAACGAAAAACACAAACTGAATGGC
ATTCTATCGTGTTCTATCGTCGCCAAGCAGAAATTTGCGGGCAGTATTTGAAGAAAGGCTCGAAAGTTTATGTGGAAGGT
AAGCTCAGAACACGCAAATGGCAAGATCAAAATGGTCAAGACCGCTACACCACAGAGATTCAAGGCGACGTATTACAAAT
GCTAGACAGTCGCCAAGATTCACAGCAACAGCAAGCACAGGCACCACAAAATAATGCTTATGCGAATGCGAAAGCTGGAA
AGCCTGTACAGCAACAAGCATATAACTTTGAAGAGGATAATATCCCATTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
60.556 |
100 |
0.727 |
| ssb | Vibrio cholerae strain A1552 |
52.518 |
92.667 |
0.487 |
| ssb | Neisseria gonorrhoeae MS11 |
44.526 |
91.333 |
0.407 |
| ssb | Neisseria meningitidis MC58 |
44.526 |
91.333 |
0.407 |