Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | OS088_RS08660 | Genome accession | NZ_CP113051 |
| Coordinates | 1687488..1687958 (-) | Length | 156 a.a. |
| NCBI ID | WP_000934760.1 | Uniprot ID | A0AAN2D761 |
| Organism | Staphylococcus aureus strain Viktor | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1656479..1707920 | 1687488..1687958 | within | 0 |
Gene organization within MGE regions
Location: 1656479..1707920
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OS088_RS08430 | scn | 1656479..1656829 (-) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| OS088_RS08435 | - | 1657341..1657679 (-) | 339 | Protein_1622 | SH3 domain-containing protein | - |
| OS088_RS08440 | sak | 1658326..1658817 (-) | 492 | WP_000920038.1 | staphylokinase | - |
| OS088_RS08445 | - | 1659008..1659763 (-) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| OS088_RS08450 | - | 1659775..1660029 (-) | 255 | WP_000611512.1 | phage holin | - |
| OS088_RS08455 | - | 1660081..1660188 (+) | 108 | WP_031762631.1 | hypothetical protein | - |
| OS088_RS08460 | pepG1 | 1660241..1660375 (-) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| OS088_RS08465 | sea | 1660526..1661300 (-) | 775 | Protein_1628 | staphylococcal enterotoxin type A | - |
| OS088_RS08470 | - | 1661673..1662047 (-) | 375 | WP_000340977.1 | hypothetical protein | - |
| OS088_RS08475 | - | 1662103..1662390 (-) | 288 | WP_001262621.1 | hypothetical protein | - |
| OS088_RS08480 | - | 1662436..1662588 (-) | 153 | WP_001000058.1 | hypothetical protein | - |
| OS088_RS08485 | - | 1662581..1666363 (-) | 3783 | WP_000582129.1 | phage tail spike protein | - |
| OS088_RS08490 | - | 1666379..1667869 (-) | 1491 | WP_001154317.1 | phage distal tail protein | - |
| OS088_RS08495 | - | 1667869..1672518 (-) | 4650 | WP_001133523.1 | phage tail tape measure protein | - |
| OS088_RS08500 | gpGT | 1672574..1672696 (-) | 123 | WP_000571956.1 | phage tail assembly chaperone GT | - |
| OS088_RS08505 | gpG | 1672756..1673202 (-) | 447 | WP_000442605.1 | phage tail assembly chaperone G | - |
| OS088_RS08510 | - | 1673267..1674220 (-) | 954 | WP_000570648.1 | major tail protein | - |
| OS088_RS08515 | - | 1674221..1674601 (-) | 381 | WP_000608371.1 | hypothetical protein | - |
| OS088_RS08520 | - | 1674598..1674975 (-) | 378 | WP_000501242.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| OS088_RS08525 | - | 1674975..1675310 (-) | 336 | WP_000975314.1 | head-tail adaptor protein | - |
| OS088_RS08530 | - | 1675297..1675629 (-) | 333 | WP_001177483.1 | head-tail connector protein | - |
| OS088_RS08535 | - | 1675638..1675796 (-) | 159 | WP_001252099.1 | hypothetical protein | - |
| OS088_RS08540 | - | 1675832..1677079 (-) | 1248 | WP_000849950.1 | phage major capsid protein | - |
| OS088_RS08545 | - | 1677167..1677751 (-) | 585 | WP_000032525.1 | HK97 family phage prohead protease | - |
| OS088_RS08550 | - | 1677744..1678994 (-) | 1251 | WP_000511067.1 | phage portal protein | - |
| OS088_RS08555 | - | 1679000..1679200 (-) | 201 | WP_000365299.1 | hypothetical protein | - |
| OS088_RS08560 | - | 1679214..1680908 (-) | 1695 | WP_000133304.1 | terminase large subunit | - |
| OS088_RS08565 | - | 1680911..1681378 (-) | 468 | WP_000919026.1 | phage terminase small subunit P27 family | - |
| OS088_RS08570 | - | 1681508..1681852 (-) | 345 | WP_000817289.1 | HNH endonuclease | - |
| OS088_RS08575 | - | 1681867..1682319 (-) | 453 | WP_000406191.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| OS088_RS08580 | - | 1682434..1682904 (-) | 471 | WP_000282755.1 | hypothetical protein | - |
| OS088_RS08585 | - | 1682927..1683127 (-) | 201 | WP_001570807.1 | DUF1514 family protein | - |
| OS088_RS08590 | rinB | 1683127..1683252 (-) | 126 | WP_031783376.1 | transcriptional activator RinB | - |
| OS088_RS08595 | - | 1683245..1683448 (-) | 204 | WP_001072793.1 | hypothetical protein | - |
| OS088_RS08600 | - | 1683445..1683639 (-) | 195 | WP_000141186.1 | hypothetical protein | - |
| OS088_RS08605 | - | 1683636..1683842 (-) | 207 | WP_000195826.1 | DUF1381 domain-containing protein | - |
| OS088_RS08610 | - | 1683879..1684412 (-) | 534 | WP_025920701.1 | dUTP diphosphatase | - |
| OS088_RS08615 | - | 1684427..1684588 (-) | 162 | WP_000889683.1 | hypothetical protein | - |
| OS088_RS08620 | - | 1684589..1684870 (-) | 282 | WP_000454994.1 | hypothetical protein | - |
| OS088_RS08625 | - | 1684871..1685044 (-) | 174 | WP_000028424.1 | hypothetical protein | - |
| OS088_RS08630 | - | 1685034..1685285 (-) | 252 | WP_025174939.1 | DUF1024 family protein | - |
| OS088_RS08635 | - | 1685300..1685542 (-) | 243 | WP_000131381.1 | phi PVL orf 51-like protein | - |
| OS088_RS08640 | - | 1685546..1685914 (-) | 369 | WP_000101275.1 | SA1788 family PVL leukocidin-associated protein | - |
| OS088_RS08645 | - | 1685927..1686331 (-) | 405 | WP_000401978.1 | RusA family crossover junction endodeoxyribonuclease | - |
| OS088_RS08650 | - | 1686340..1686558 (-) | 219 | WP_000338527.1 | hypothetical protein | - |
| OS088_RS08655 | - | 1686565..1687458 (-) | 894 | WP_000148335.1 | DnaD domain protein | - |
| OS088_RS08660 | ssbA | 1687488..1687958 (-) | 471 | WP_000934760.1 | single-stranded DNA-binding protein | Machinery gene |
| OS088_RS08665 | - | 1687959..1688576 (-) | 618 | WP_071621397.1 | MBL fold metallo-hydrolase | - |
| OS088_RS08670 | - | 1688657..1689577 (-) | 921 | WP_000138475.1 | recombinase RecT | - |
| OS088_RS08675 | - | 1689579..1691518 (-) | 1940 | Protein_1670 | AAA family ATPase | - |
| OS088_RS08680 | - | 1691527..1691790 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| OS088_RS08685 | - | 1691799..1692059 (-) | 261 | WP_000291488.1 | DUF1108 family protein | - |
| OS088_RS08690 | - | 1692152..1692313 (-) | 162 | WP_000066020.1 | DUF1270 domain-containing protein | - |
| OS088_RS08695 | - | 1692310..1692630 (-) | 321 | WP_001120197.1 | DUF771 domain-containing protein | - |
| OS088_RS08700 | - | 1692689..1693321 (+) | 633 | WP_000275058.1 | hypothetical protein | - |
| OS088_RS08705 | - | 1693336..1693476 (-) | 141 | WP_267814058.1 | hypothetical protein | - |
| OS088_RS08710 | - | 1693507..1693704 (-) | 198 | WP_001148861.1 | hypothetical protein | - |
| OS088_RS08715 | - | 1693720..1694469 (-) | 750 | WP_001148337.1 | phage antirepressor KilAC domain-containing protein | - |
| OS088_RS08720 | - | 1694526..1695065 (+) | 540 | WP_000351243.1 | hypothetical protein | - |
| OS088_RS08725 | - | 1695089..1695349 (-) | 261 | WP_000435341.1 | transcriptional regulator | - |
| OS088_RS08730 | - | 1695367..1695591 (-) | 225 | WP_000338185.1 | DUF739 family protein | - |
| OS088_RS08735 | - | 1695750..1696520 (+) | 771 | WP_031783378.1 | S24 family peptidase | - |
| OS088_RS08740 | - | 1696720..1696902 (+) | 183 | WP_000705240.1 | hypothetical protein | - |
| OS088_RS08745 | - | 1696938..1697084 (+) | 147 | WP_001013104.1 | hypothetical protein | - |
| OS088_RS08750 | - | 1697081..1697695 (-) | 615 | WP_267814059.1 | ATPase | - |
| OS088_RS08755 | - | 1697803..1698840 (+) | 1038 | WP_000857176.1 | tyrosine-type recombinase/integrase | - |
| OS088_RS08760 | sph | 1698897..1699721 (+) | 825 | Protein_1687 | sphingomyelin phosphodiesterase | - |
| OS088_RS08765 | - | 1699978..1700997 (-) | 1020 | WP_154283943.1 | leukocidin/hemolysin toxin family protein | - |
| OS088_RS08770 | - | 1701019..1702074 (-) | 1056 | WP_154283942.1 | leukocidin family pore-forming toxin | - |
| OS088_RS08775 | - | 1702506..1703729 (+) | 1224 | WP_154283941.1 | ArgE/DapE family deacylase | - |
| OS088_RS08780 | - | 1704112..1705419 (+) | 1308 | WP_154283940.1 | TrkH family potassium uptake protein | - |
| OS088_RS08785 | groL | 1705944..1707560 (-) | 1617 | WP_000240642.1 | chaperonin GroEL | - |
| OS088_RS08790 | groES | 1707636..1707920 (-) | 285 | WP_000917289.1 | co-chaperone GroES | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17641.52 Da Isoelectric Point: 5.2672
>NTDB_id=759597 OS088_RS08660 WP_000934760.1 1687488..1687958(-) (ssbA) [Staphylococcus aureus strain Viktor]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=759597 OS088_RS08660 WP_000934760.1 1687488..1687958(-) (ssbA) [Staphylococcus aureus strain Viktor]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTGA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.768 |
100 |
0.372 |
| ssb | Neisseria meningitidis MC58 |
32.948 |
100 |
0.365 |
| ssb | Neisseria gonorrhoeae MS11 |
32.948 |
100 |
0.365 |