Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | ORY89_RS06420 | Genome accession | NZ_CP111148 |
| Coordinates | 1280267..1280749 (+) | Length | 160 a.a. |
| NCBI ID | WP_200339529.1 | Uniprot ID | - |
| Organism | Listeria monocytogenes strain 16-02236 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1264924..1310769 | 1280267..1280749 | within | 0 |
Gene organization within MGE regions
Location: 1264924..1310769
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORY89_RS06290 (ORY89_06290) | - | 1264924..1265448 (+) | 525 | WP_003726034.1 | metallophosphoesterase | - |
| ORY89_RS06300 (ORY89_06300) | - | 1265717..1266847 (-) | 1131 | WP_200339569.1 | site-specific integrase | - |
| ORY89_RS06305 (ORY89_06305) | - | 1266912..1267796 (-) | 885 | WP_200339567.1 | hypothetical protein | - |
| ORY89_RS06310 (ORY89_06310) | - | 1267851..1268000 (-) | 150 | WP_200339565.1 | hypothetical protein | - |
| ORY89_RS06315 (ORY89_06315) | - | 1268154..1268639 (-) | 486 | WP_200339563.1 | helix-turn-helix domain-containing protein | - |
| ORY89_RS06320 (ORY89_06320) | - | 1268808..1269005 (+) | 198 | WP_200339561.1 | helix-turn-helix transcriptional regulator | - |
| ORY89_RS06325 (ORY89_06325) | - | 1269045..1269833 (+) | 789 | WP_200339559.1 | phage antirepressor KilAC domain-containing protein | - |
| ORY89_RS06330 (ORY89_06330) | - | 1269957..1270481 (+) | 525 | WP_200339557.1 | hypothetical protein | - |
| ORY89_RS06335 (ORY89_06335) | - | 1270488..1270724 (+) | 237 | WP_003731810.1 | DUF771 domain-containing protein | - |
| ORY89_RS06340 (ORY89_06340) | - | 1270829..1271017 (+) | 189 | WP_176903592.1 | gp45 family putative tail fiber system protein | - |
| ORY89_RS06345 (ORY89_06345) | - | 1271253..1272764 (+) | 1512 | WP_200339555.1 | AAA family ATPase | - |
| ORY89_RS06350 (ORY89_06350) | - | 1272757..1273668 (+) | 912 | WP_200339553.1 | RecT family recombinase | - |
| ORY89_RS06355 (ORY89_06355) | - | 1273679..1274593 (+) | 915 | WP_200339551.1 | hypothetical protein | - |
| ORY89_RS06360 (ORY89_06360) | - | 1274590..1274796 (+) | 207 | Protein_1249 | class I SAM-dependent methyltransferase | - |
| ORY89_RS06365 (ORY89_06365) | - | 1274825..1275283 (+) | 459 | WP_200339549.1 | hypothetical protein | - |
| ORY89_RS06370 (ORY89_06370) | - | 1275297..1275977 (+) | 681 | WP_200339547.1 | N-6 DNA methylase | - |
| ORY89_RS06375 (ORY89_06375) | - | 1276018..1276959 (+) | 942 | WP_200339545.1 | tyrosine-type recombinase/integrase | - |
| ORY89_RS06380 (ORY89_06380) | - | 1276971..1277597 (+) | 627 | WP_200339543.1 | hypothetical protein | - |
| ORY89_RS06385 (ORY89_06385) | - | 1277654..1278055 (+) | 402 | WP_200339541.1 | hypothetical protein | - |
| ORY89_RS06390 (ORY89_06390) | - | 1278045..1278680 (+) | 636 | WP_200339539.1 | DUF1642 domain-containing protein | - |
| ORY89_RS06395 (ORY89_06395) | - | 1278677..1278943 (+) | 267 | WP_200339537.1 | hypothetical protein | - |
| ORY89_RS06400 (ORY89_06400) | - | 1278940..1279197 (+) | 258 | WP_200339535.1 | DUF3850 domain-containing protein | - |
| ORY89_RS06405 (ORY89_06405) | - | 1279188..1279517 (+) | 330 | WP_187127224.1 | hypothetical protein | - |
| ORY89_RS06410 (ORY89_06410) | - | 1279514..1279738 (+) | 225 | WP_200339533.1 | hypothetical protein | - |
| ORY89_RS06415 (ORY89_06415) | - | 1279726..1280049 (+) | 324 | WP_200339531.1 | hypothetical protein | - |
| ORY89_RS06420 (ORY89_06420) | ssbA | 1280267..1280749 (+) | 483 | WP_200339529.1 | single-stranded DNA-binding protein | Machinery gene |
| ORY89_RS06425 (ORY89_06425) | - | 1280770..1281075 (+) | 306 | WP_200339527.1 | response regulator | - |
| ORY89_RS06430 (ORY89_06430) | - | 1281072..1281212 (+) | 141 | WP_200339525.1 | BH0509 family protein | - |
| ORY89_RS06435 (ORY89_06435) | - | 1281178..1281582 (+) | 405 | WP_200339523.1 | hypothetical protein | - |
| ORY89_RS06440 (ORY89_06440) | - | 1281723..1281878 (+) | 156 | WP_003719486.1 | hypothetical protein | - |
| ORY89_RS06445 (ORY89_06445) | - | 1281968..1282540 (+) | 573 | WP_200339588.1 | sigma-70 family RNA polymerase sigma factor | - |
| ORY89_RS06450 (ORY89_06450) | - | 1282784..1283092 (+) | 309 | WP_194322988.1 | hypothetical protein | - |
| ORY89_RS06455 (ORY89_06455) | - | 1283158..1283967 (+) | 810 | WP_200339521.1 | terminase small subunit | - |
| ORY89_RS06460 (ORY89_06460) | - | 1283936..1285267 (+) | 1332 | WP_200339519.1 | PBSX family phage terminase large subunit | - |
| ORY89_RS06465 (ORY89_06465) | - | 1285280..1286770 (+) | 1491 | WP_200339586.1 | phage portal protein | - |
| ORY89_RS06470 (ORY89_06470) | - | 1286776..1287915 (+) | 1140 | WP_200339517.1 | phage minor capsid protein | - |
| ORY89_RS06475 (ORY89_06475) | - | 1287994..1288566 (+) | 573 | WP_200339515.1 | phage scaffolding protein | - |
| ORY89_RS06480 (ORY89_06480) | - | 1288592..1289542 (+) | 951 | WP_200339513.1 | phage major capsid protein | - |
| ORY89_RS06485 (ORY89_06485) | - | 1289539..1289700 (+) | 162 | WP_234288388.1 | HeH/LEM domain-containing protein | - |
| ORY89_RS06490 (ORY89_06490) | - | 1289702..1290097 (+) | 396 | WP_200339509.1 | hypothetical protein | - |
| ORY89_RS06495 (ORY89_06495) | - | 1290097..1290459 (+) | 363 | WP_200339507.1 | putative minor capsid protein | - |
| ORY89_RS06500 (ORY89_06500) | - | 1290459..1290797 (+) | 339 | WP_061106990.1 | minor capsid protein | - |
| ORY89_RS06505 (ORY89_06505) | - | 1290797..1291204 (+) | 408 | WP_200339505.1 | minor capsid protein | - |
| ORY89_RS06510 (ORY89_06510) | - | 1291207..1291644 (+) | 438 | WP_039177495.1 | hypothetical protein | - |
| ORY89_RS06515 (ORY89_06515) | - | 1291574..1291906 (+) | 333 | WP_234288387.1 | Ig-like domain-containing protein | - |
| ORY89_RS06520 (ORY89_06520) | - | 1291961..1292383 (+) | 423 | WP_200339503.1 | phage tail assembly chaperone | - |
| ORY89_RS06525 (ORY89_06525) | - | 1292389..1292988 (+) | 600 | WP_200339501.1 | Gp15 family bacteriophage protein | - |
| ORY89_RS06530 (ORY89_06530) | - | 1293004..1297692 (+) | 4689 | WP_200339499.1 | tape measure protein | - |
| ORY89_RS06535 (ORY89_06535) | - | 1297694..1298512 (+) | 819 | WP_200339497.1 | phage tail family protein | - |
| ORY89_RS06540 (ORY89_06540) | - | 1298521..1299546 (+) | 1026 | WP_200339495.1 | phage tail protein | - |
| ORY89_RS06545 (ORY89_06545) | - | 1299547..1300581 (+) | 1035 | WP_200339493.1 | hypothetical protein | - |
| ORY89_RS06550 (ORY89_06550) | - | 1300578..1301654 (+) | 1077 | WP_200339491.1 | phage baseplate upper protein | - |
| ORY89_RS06555 (ORY89_06555) | - | 1301651..1301929 (+) | 279 | WP_200339489.1 | hypothetical protein | - |
| ORY89_RS06560 (ORY89_06560) | - | 1301935..1302087 (+) | 153 | WP_200339487.1 | CD1375 family protein | - |
| ORY89_RS06565 (ORY89_06565) | - | 1302123..1302506 (+) | 384 | WP_200339485.1 | hypothetical protein | - |
| ORY89_RS06570 (ORY89_06570) | - | 1302525..1302782 (+) | 258 | WP_038406822.1 | phage holin | - |
| ORY89_RS06575 (ORY89_06575) | - | 1302785..1303645 (+) | 861 | WP_200339483.1 | N-acetylmuramoyl-L-alanine amidase family protein | - |
| ORY89_RS06580 (ORY89_06580) | - | 1303888..1304067 (+) | 180 | WP_200339481.1 | hypothetical protein | - |
| ORY89_RS06585 (ORY89_06585) | - | 1304067..1304612 (+) | 546 | WP_200339479.1 | GNAT family N-acetyltransferase | - |
| ORY89_RS06590 (ORY89_06590) | - | 1304831..1305280 (-) | 450 | WP_200339477.1 | helix-turn-helix domain-containing protein | - |
| ORY89_RS06595 (ORY89_06595) | - | 1305282..1305671 (-) | 390 | WP_200339475.1 | AcrIIA2 family anti-CRISPR protein | - |
| ORY89_RS06600 (ORY89_06600) | - | 1305760..1305960 (-) | 201 | WP_200339473.1 | hypothetical protein | - |
| ORY89_RS06605 (ORY89_06605) | - | 1307172..1307645 (+) | 474 | WP_003726037.1 | hypothetical protein | - |
| ORY89_RS06610 (ORY89_06610) | - | 1307751..1308113 (+) | 363 | WP_003726038.1 | Imm51 family immunity protein | - |
| ORY89_RS06615 (ORY89_06615) | - | 1308231..1309589 (+) | 1359 | WP_003727539.1 | DUF1254 domain-containing protein | - |
| ORY89_RS06620 (ORY89_06620) | - | 1309632..1310225 (-) | 594 | WP_003726043.1 | YdeI family protein | - |
| ORY89_RS06625 (ORY89_06625) | - | 1310362..1310769 (-) | 408 | WP_003726044.1 | glyoxalase/bleomycin resistance/extradiol dioxygenase family protein | - |
Sequence
Protein
Download Length: 160 a.a. Molecular weight: 17972.90 Da Isoelectric Point: 5.0261
>NTDB_id=758229 ORY89_RS06420 WP_200339529.1 1280267..1280749(+) (ssbA) [Listeria monocytogenes strain 16-02236]
MMNRVVLVGRLTKDPELRYTPAGVAVATFTLAVNRTFTNQQGEREADFINCVVWRKPAENVVNFLKKGSMAGVDGRVQTR
NYEGNDGKRVYVTEVVAESVQFLDPKNNGLEGSTSNNYRNEVNYSNNSESVPYRADTSQRKDNFANEGKPIDINEDDLPF
MMNRVVLVGRLTKDPELRYTPAGVAVATFTLAVNRTFTNQQGEREADFINCVVWRKPAENVVNFLKKGSMAGVDGRVQTR
NYEGNDGKRVYVTEVVAESVQFLDPKNNGLEGSTSNNYRNEVNYSNNSESVPYRADTSQRKDNFANEGKPIDINEDDLPF
Nucleotide
Download Length: 483 bp
>NTDB_id=758229 ORY89_RS06420 WP_200339529.1 1280267..1280749(+) (ssbA) [Listeria monocytogenes strain 16-02236]
ATGATGAATCGTGTTGTACTTGTAGGACGTTTAACGAAAGATCCTGAATTACGTTATACCCCGGCTGGCGTGGCTGTTGC
GACTTTTACATTAGCTGTAAATCGTACGTTCACTAACCAACAAGGGGAACGAGAAGCTGACTTTATTAATTGTGTTGTTT
GGCGCAAACCAGCTGAAAATGTTGTTAATTTCTTAAAAAAAGGAAGCATGGCAGGTGTTGATGGCCGCGTTCAAACTCGT
AACTACGAAGGAAACGATGGCAAACGTGTTTATGTGACAGAAGTAGTTGCTGAATCAGTTCAATTTTTAGACCCTAAGAA
TAATGGTCTAGAAGGCTCAACATCGAATAATTATCGAAATGAAGTTAATTATTCAAATAACAGCGAATCAGTTCCATATC
GAGCGGATACGAGCCAGAGAAAAGATAATTTTGCAAATGAAGGCAAGCCAATAGATATTAACGAAGACGATTTACCATTC
TAA
ATGATGAATCGTGTTGTACTTGTAGGACGTTTAACGAAAGATCCTGAATTACGTTATACCCCGGCTGGCGTGGCTGTTGC
GACTTTTACATTAGCTGTAAATCGTACGTTCACTAACCAACAAGGGGAACGAGAAGCTGACTTTATTAATTGTGTTGTTT
GGCGCAAACCAGCTGAAAATGTTGTTAATTTCTTAAAAAAAGGAAGCATGGCAGGTGTTGATGGCCGCGTTCAAACTCGT
AACTACGAAGGAAACGATGGCAAACGTGTTTATGTGACAGAAGTAGTTGCTGAATCAGTTCAATTTTTAGACCCTAAGAA
TAATGGTCTAGAAGGCTCAACATCGAATAATTATCGAAATGAAGTTAATTATTCAAATAACAGCGAATCAGTTCCATATC
GAGCGGATACGAGCCAGAGAAAAGATAATTTTGCAAATGAAGGCAAGCCAATAGATATTAACGAAGACGATTTACCATTC
TAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
63.953 |
100 |
0.687 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
54.118 |
100 |
0.575 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
63.208 |
66.25 |
0.419 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
38.75 |
100 |
0.388 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
36.25 |
100 |
0.363 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
36.25 |
100 |
0.363 |