Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   N9E61_RS14740 Genome accession   NZ_CP106872
Coordinates   2998074..2998214 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain STJ-6     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2993074..3003214
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  N9E61_RS14715 (N9E61_14715) - 2993420..2993803 (-) 384 WP_007613430.1 hotdog fold thioesterase -
  N9E61_RS14720 (N9E61_14720) comA 2993825..2994469 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  N9E61_RS14725 (N9E61_14725) comP 2994550..2996850 (-) 2301 WP_032876801.1 histidine kinase Regulator
  N9E61_RS14730 (N9E61_14730) comX 2996864..2997037 (-) 174 WP_012118314.1 competence pheromone ComX -
  N9E61_RS14735 (N9E61_14735) - 2997006..2997866 (-) 861 WP_142925231.1 polyprenyl synthetase family protein -
  N9E61_RS14740 (N9E61_14740) degQ 2998074..2998214 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  N9E61_RS14745 (N9E61_14745) - 2998680..2999021 (+) 342 WP_032876795.1 hypothetical protein -
  N9E61_RS14750 (N9E61_14750) - 2999028..3000251 (-) 1224 WP_032876792.1 EAL and HDOD domain-containing protein -
  N9E61_RS14755 (N9E61_14755) - 3000381..3001847 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  N9E61_RS14760 (N9E61_14760) - 3001865..3002416 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  N9E61_RS14765 (N9E61_14765) - 3002513..3002911 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=736264 N9E61_RS14740 WP_003152043.1 2998074..2998214(-) (degQ) [Bacillus velezensis strain STJ-6]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=736264 N9E61_RS14740 WP_003152043.1 2998074..2998214(-) (degQ) [Bacillus velezensis strain STJ-6]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891