Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | NW947_RS04520 | Genome accession | NZ_CP102967 |
| Coordinates | 937359..937829 (+) | Length | 156 a.a. |
| NCBI ID | WP_258416677.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain 17-H-61 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 926758..967332 | 937359..937829 | within | 0 |
Gene organization within MGE regions
Location: 926758..967332
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW947_RS04430 (NW947_04430) | - | 926758..926940 (+) | 183 | Protein_863 | competence protein CoiA family protein | - |
| NW947_RS04435 (NW947_04435) | - | 927033..928238 (-) | 1206 | WP_258416666.1 | site-specific integrase | - |
| NW947_RS04440 (NW947_04440) | - | 928363..928941 (+) | 579 | WP_258416667.1 | hypothetical protein | - |
| NW947_RS04445 (NW947_04445) | - | 928938..929129 (-) | 192 | WP_252559444.1 | hypothetical protein | - |
| NW947_RS04450 (NW947_04450) | - | 929204..929818 (-) | 615 | WP_258416669.1 | hypothetical protein | - |
| NW947_RS04455 (NW947_04455) | - | 929833..930462 (-) | 630 | WP_047447805.1 | XRE family transcriptional regulator | - |
| NW947_RS04460 (NW947_04460) | - | 930659..930868 (+) | 210 | WP_258416670.1 | helix-turn-helix transcriptional regulator | - |
| NW947_RS04465 (NW947_04465) | - | 930884..931201 (+) | 318 | WP_196429542.1 | hypothetical protein | - |
| NW947_RS04470 (NW947_04470) | - | 931351..931584 (-) | 234 | WP_047447799.1 | hypothetical protein | - |
| NW947_RS04475 (NW947_04475) | - | 931645..932400 (+) | 756 | WP_258416673.1 | phage regulatory protein/antirepressor Ant | - |
| NW947_RS04480 (NW947_04480) | - | 932415..932678 (+) | 264 | WP_115207353.1 | helix-turn-helix domain-containing protein | - |
| NW947_RS04485 (NW947_04485) | - | 932691..932852 (+) | 162 | WP_209025520.1 | DUF1270 family protein | - |
| NW947_RS04490 (NW947_04490) | - | 932947..933273 (+) | 327 | WP_234726024.1 | DUF2482 family protein | - |
| NW947_RS04495 (NW947_04495) | - | 933254..933514 (+) | 261 | WP_258416674.1 | DUF1108 family protein | - |
| NW947_RS04500 (NW947_04500) | - | 933523..933786 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| NW947_RS04505 (NW947_04505) | - | 933783..935738 (+) | 1956 | WP_258416675.1 | AAA family ATPase | - |
| NW947_RS04510 (NW947_04510) | - | 935740..936660 (+) | 921 | WP_258416676.1 | recombinase RecT | - |
| NW947_RS04515 (NW947_04515) | - | 936741..937358 (+) | 618 | WP_077517322.1 | MBL fold metallo-hydrolase | - |
| NW947_RS04520 (NW947_04520) | ssbA | 937359..937829 (+) | 471 | WP_258416677.1 | single-stranded DNA-binding protein | Machinery gene |
| NW947_RS04525 (NW947_04525) | - | 937859..938743 (+) | 885 | WP_258416678.1 | DnaD domain protein | - |
| NW947_RS04530 (NW947_04530) | - | 938750..938968 (+) | 219 | WP_258411812.1 | hypothetical protein | - |
| NW947_RS04535 (NW947_04535) | - | 938977..939381 (+) | 405 | WP_258416679.1 | RusA family crossover junction endodeoxyribonuclease | - |
| NW947_RS04540 (NW947_04540) | - | 939394..939765 (+) | 372 | WP_258416680.1 | SA1788 family PVL leukocidin-associated protein | - |
| NW947_RS04545 (NW947_04545) | - | 939769..939984 (+) | 216 | WP_258416681.1 | phi PVL orf 51-like protein | - |
| NW947_RS04550 (NW947_04550) | - | 939999..940205 (+) | 207 | WP_258416805.1 | hypothetical protein | - |
| NW947_RS04555 (NW947_04555) | - | 940208..940612 (+) | 405 | WP_258416682.1 | hypothetical protein | - |
| NW947_RS04560 (NW947_04560) | - | 940609..940803 (+) | 195 | WP_043044204.1 | hypothetical protein | - |
| NW947_RS04565 (NW947_04565) | - | 940800..941225 (+) | 426 | WP_258416683.1 | YopX family protein | - |
| NW947_RS04570 (NW947_04570) | - | 941239..941505 (+) | 267 | Protein_891 | hypothetical protein | - |
| NW947_RS04575 (NW947_04575) | - | 941810..942058 (+) | 249 | WP_258416685.1 | DUF1024 family protein | - |
| NW947_RS04580 (NW947_04580) | - | 942051..942587 (+) | 537 | WP_031761846.1 | dUTPase | - |
| NW947_RS04585 (NW947_04585) | - | 942624..942797 (+) | 174 | WP_001209216.1 | hypothetical protein | - |
| NW947_RS04590 (NW947_04590) | - | 942814..943020 (+) | 207 | WP_031761844.1 | DUF1381 domain-containing protein | - |
| NW947_RS04595 (NW947_04595) | - | 943017..943403 (+) | 387 | WP_000592207.1 | hypothetical protein | - |
| NW947_RS04600 (NW947_04600) | - | 943400..943549 (+) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| NW947_RS04605 (NW947_04605) | - | 943549..943749 (+) | 201 | WP_000265043.1 | DUF1514 family protein | - |
| NW947_RS04610 (NW947_04610) | - | 943777..944193 (+) | 417 | WP_000590122.1 | hypothetical protein | - |
| NW947_RS04615 (NW947_04615) | - | 944425..944724 (+) | 300 | WP_000988336.1 | HNH endonuclease | - |
| NW947_RS04620 (NW947_04620) | - | 944854..945198 (+) | 345 | WP_000402904.1 | hypothetical protein | - |
| NW947_RS04625 (NW947_04625) | - | 945195..946856 (+) | 1662 | WP_258416696.1 | terminase large subunit | - |
| NW947_RS04630 (NW947_04630) | - | 946871..948019 (+) | 1149 | WP_000511812.1 | phage portal protein | - |
| NW947_RS04635 (NW947_04635) | - | 948016..948738 (+) | 723 | WP_258411282.1 | head maturation protease, ClpP-related | - |
| NW947_RS04640 (NW947_04640) | - | 948764..949903 (+) | 1140 | WP_258415214.1 | phage major capsid protein | - |
| NW947_RS04645 (NW947_04645) | - | 949922..950200 (+) | 279 | WP_000005716.1 | hypothetical protein | - |
| NW947_RS04650 (NW947_04650) | - | 950209..950490 (+) | 282 | WP_258411279.1 | phage head-tail adapter protein | - |
| NW947_RS04655 (NW947_04655) | - | 950474..950836 (+) | 363 | WP_031872356.1 | head-tail adaptor protein | - |
| NW947_RS04660 (NW947_04660) | - | 950833..951237 (+) | 405 | WP_070004532.1 | HK97 gp10 family phage protein | - |
| NW947_RS04665 (NW947_04665) | - | 951234..951638 (+) | 405 | WP_000565500.1 | hypothetical protein | - |
| NW947_RS04670 (NW947_04670) | - | 951642..952286 (+) | 645 | WP_258416697.1 | major tail protein | - |
| NW947_RS04675 (NW947_04675) | - | 952313..952552 (+) | 240 | WP_094969769.1 | Ig-like domain-containing protein | - |
| NW947_RS04680 (NW947_04680) | - | 952602..952952 (+) | 351 | WP_031906184.1 | hypothetical protein | - |
| NW947_RS04685 (NW947_04685) | - | 953003..953140 (+) | 138 | WP_001549167.1 | hypothetical protein | - |
| NW947_RS04690 (NW947_04690) | - | 953197..957720 (+) | 4524 | WP_258414923.1 | phage tail tape measure protein | - |
| NW947_RS04695 (NW947_04695) | - | 957720..959204 (+) | 1485 | WP_258414922.1 | phage tail family protein | - |
| NW947_RS04700 (NW947_04700) | - | 959220..963827 (+) | 4608 | WP_258416699.1 | phage tail spike protein | - |
| NW947_RS04705 (NW947_04705) | - | 963820..963972 (+) | 153 | WP_196429569.1 | hypothetical protein | - |
| NW947_RS04710 (NW947_04710) | - | 964018..964305 (+) | 288 | WP_031763773.1 | hypothetical protein | - |
| NW947_RS04715 (NW947_04715) | - | 964361..964735 (+) | 375 | WP_000340977.1 | hypothetical protein | - |
| NW947_RS04720 (NW947_04720) | - | 964862..965164 (+) | 303 | WP_251359527.1 | phage holin | - |
| NW947_RS04725 (NW947_04725) | - | 965175..966629 (+) | 1455 | WP_258416701.1 | N-acetylmuramoyl-L-alanine amidase | - |
| NW947_RS04730 (NW947_04730) | - | 967015..967197 (+) | 183 | Protein_923 | DNA-binding protein | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17669.58 Da Isoelectric Point: 5.2672
>NTDB_id=720740 NW947_RS04520 WP_258416677.1 937359..937829(+) (ssbA) [Staphylococcus aureus strain 17-H-61]
MINRTILVGRLTRDPELRITQSGVNVASFTLAVNRTFTNAQGEREADFINVIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNTNDNQQDLYQQQAQQSRGQSQYPYNKPVKDNPFANANGPIEIDDNDLPF
MINRTILVGRLTRDPELRITQSGVNVASFTLAVNRTFTNAQGEREADFINVIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNTNDNQQDLYQQQAQQSRGQSQYPYNKPVKDNPFANANGPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=720740 NW947_RS04520 WP_258416677.1 937359..937829(+) (ssbA) [Staphylococcus aureus strain 17-H-61]
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAATCACGCAAAGCGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACGAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATGTCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATATCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAGAA
CACAAATGATAATCAACAAGATTTATACCAACAACAAGCGCAACAATCACGTGGACAGTCTCAATATCCATATAACAAAC
CAGTAAAAGATAATCCGTTCGCAAATGCGAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAATCACGCAAAGCGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACGAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATGTCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATATCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAGAA
CACAAATGATAATCAACAAGATTTATACCAACAACAAGCGCAACAATCACGTGGACAGTCTCAATATCCATATAACAAAC
CAGTAAAAGATAATCCGTTCGCAAATGCGAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
54.802 |
100 |
0.622 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.765 |
100 |
0.564 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Vibrio cholerae strain A1552 |
32.402 |
100 |
0.372 |
| ssb | Neisseria meningitidis MC58 |
32.948 |
100 |
0.365 |
| ssb | Neisseria gonorrhoeae MS11 |
32.948 |
100 |
0.365 |