Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | NW967_RS11215 | Genome accession | NZ_CP102952 |
| Coordinates | 2283996..2284466 (-) | Length | 156 a.a. |
| NCBI ID | WP_258411292.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain 39-B-49 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2254281..2307322 | 2283996..2284466 | within | 0 |
Gene organization within MGE regions
Location: 2254281..2307322
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW967_RS11010 (NW967_11010) | - | 2254416..2254598 (-) | 183 | Protein_2121 | DNA-binding protein | - |
| NW967_RS11015 (NW967_11015) | - | 2254983..2256437 (-) | 1455 | WP_258411272.1 | N-acetylmuramoyl-L-alanine amidase | - |
| NW967_RS11020 (NW967_11020) | - | 2256448..2256750 (-) | 303 | WP_251359527.1 | phage holin | - |
| NW967_RS11025 (NW967_11025) | - | 2256877..2257251 (-) | 375 | WP_000340977.1 | hypothetical protein | - |
| NW967_RS11030 (NW967_11030) | - | 2257307..2257594 (-) | 288 | WP_031763773.1 | hypothetical protein | - |
| NW967_RS11035 (NW967_11035) | - | 2257640..2257792 (-) | 153 | WP_196429569.1 | hypothetical protein | - |
| NW967_RS11040 (NW967_11040) | - | 2257785..2262392 (-) | 4608 | WP_258411274.1 | phage tail spike protein | - |
| NW967_RS11045 (NW967_11045) | - | 2262408..2263892 (-) | 1485 | WP_258411275.1 | phage tail family protein | - |
| NW967_RS11050 (NW967_11050) | - | 2263892..2268415 (-) | 4524 | WP_258411276.1 | phage tail tape measure protein | - |
| NW967_RS11055 (NW967_11055) | - | 2268472..2268606 (-) | 135 | WP_000364140.1 | hypothetical protein | - |
| NW967_RS11060 (NW967_11060) | - | 2268660..2269010 (-) | 351 | WP_031906184.1 | hypothetical protein | - |
| NW967_RS11065 (NW967_11065) | - | 2269060..2269299 (-) | 240 | WP_150530609.1 | Ig-like domain-containing protein | - |
| NW967_RS11070 (NW967_11070) | - | 2269326..2269970 (-) | 645 | WP_258411277.1 | major tail protein | - |
| NW967_RS11075 (NW967_11075) | - | 2269974..2270378 (-) | 405 | WP_000565500.1 | hypothetical protein | - |
| NW967_RS11080 (NW967_11080) | - | 2270375..2270779 (-) | 405 | WP_258411278.1 | HK97 gp10 family phage protein | - |
| NW967_RS11085 (NW967_11085) | - | 2270776..2271138 (-) | 363 | WP_221614136.1 | head-tail adaptor protein | - |
| NW967_RS11090 (NW967_11090) | - | 2271122..2271403 (-) | 282 | WP_258411279.1 | phage head-tail adapter protein | - |
| NW967_RS11095 (NW967_11095) | - | 2271412..2271690 (-) | 279 | WP_258411280.1 | hypothetical protein | - |
| NW967_RS11100 (NW967_11100) | - | 2271709..2272848 (-) | 1140 | WP_258411281.1 | phage major capsid protein | - |
| NW967_RS11105 (NW967_11105) | - | 2272872..2273594 (-) | 723 | WP_258411282.1 | head maturation protease, ClpP-related | - |
| NW967_RS11110 (NW967_11110) | - | 2273591..2274739 (-) | 1149 | WP_070004535.1 | phage portal protein | - |
| NW967_RS11115 (NW967_11115) | - | 2274754..2276415 (-) | 1662 | WP_258411283.1 | terminase large subunit | - |
| NW967_RS11120 (NW967_11120) | - | 2276412..2276756 (-) | 345 | WP_000402904.1 | hypothetical protein | - |
| NW967_RS11125 (NW967_11125) | - | 2276886..2277185 (-) | 300 | WP_000988332.1 | HNH endonuclease | - |
| NW967_RS11130 (NW967_11130) | - | 2277417..2277833 (-) | 417 | WP_000590126.1 | hypothetical protein | - |
| NW967_RS11135 (NW967_11135) | - | 2277861..2278061 (-) | 201 | WP_000265041.1 | DUF1514 family protein | - |
| NW967_RS11140 (NW967_11140) | - | 2278061..2278210 (-) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| NW967_RS11145 (NW967_11145) | - | 2278203..2278403 (-) | 201 | WP_258410179.1 | hypothetical protein | - |
| NW967_RS11150 (NW967_11150) | - | 2278400..2278606 (-) | 207 | WP_258410180.1 | DUF1381 domain-containing protein | - |
| NW967_RS11155 (NW967_11155) | - | 2278762..2279022 (-) | 261 | WP_258410181.1 | hypothetical protein | - |
| NW967_RS11160 (NW967_11160) | - | 2279059..2279595 (-) | 537 | WP_258411284.1 | dUTPase | - |
| NW967_RS11165 (NW967_11165) | - | 2279951..2280076 (-) | 126 | Protein_2152 | DUF1024 family protein | - |
| NW967_RS11170 (NW967_11170) | - | 2280069..2280479 (-) | 411 | WP_153100471.1 | acetyltransferase | - |
| NW967_RS11175 (NW967_11175) | - | 2280476..2280985 (-) | 510 | WP_258411285.1 | hypothetical protein | - |
| NW967_RS11180 (NW967_11180) | - | 2280982..2281398 (-) | 417 | WP_258411286.1 | YopX family protein | - |
| NW967_RS11185 (NW967_11185) | - | 2281395..2281802 (-) | 408 | WP_258411287.1 | hypothetical protein | - |
| NW967_RS11190 (NW967_11190) | - | 2281817..2282059 (-) | 243 | WP_258411288.1 | phi PVL orf 51-like protein | - |
| NW967_RS11195 (NW967_11195) | - | 2282063..2282431 (-) | 369 | WP_258411289.1 | SA1788 family PVL leukocidin-associated protein | - |
| NW967_RS11200 (NW967_11200) | - | 2282444..2282848 (-) | 405 | WP_258411290.1 | RusA family crossover junction endodeoxyribonuclease | - |
| NW967_RS11205 (NW967_11205) | - | 2282857..2283075 (-) | 219 | WP_000338527.1 | hypothetical protein | - |
| NW967_RS11210 (NW967_11210) | - | 2283082..2283966 (-) | 885 | WP_258411291.1 | DnaD domain protein | - |
| NW967_RS11215 (NW967_11215) | ssbA | 2283996..2284466 (-) | 471 | WP_258411292.1 | single-stranded DNA-binding protein | Machinery gene |
| NW967_RS11220 (NW967_11220) | - | 2284467..2285084 (-) | 618 | WP_077517322.1 | MBL fold metallo-hydrolase | - |
| NW967_RS11225 (NW967_11225) | - | 2285165..2286085 (-) | 921 | WP_258411293.1 | recombinase RecT | - |
| NW967_RS11230 (NW967_11230) | - | 2286087..2288030 (-) | 1944 | WP_258411294.1 | AAA family ATPase | - |
| NW967_RS11235 (NW967_11235) | - | 2288039..2288302 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| NW967_RS11240 (NW967_11240) | - | 2288311..2288571 (-) | 261 | WP_113555199.1 | DUF1108 family protein | - |
| NW967_RS11245 (NW967_11245) | - | 2288576..2288878 (-) | 303 | WP_258411295.1 | DUF2482 family protein | - |
| NW967_RS11250 (NW967_11250) | - | 2288973..2289134 (-) | 162 | WP_209025520.1 | DUF1270 family protein | - |
| NW967_RS11255 (NW967_11255) | - | 2289147..2289410 (-) | 264 | WP_115207353.1 | helix-turn-helix domain-containing protein | - |
| NW967_RS11260 (NW967_11260) | - | 2289425..2290180 (-) | 756 | WP_258411296.1 | phage regulatory protein/antirepressor Ant | - |
| NW967_RS11265 (NW967_11265) | - | 2290236..2290616 (+) | 381 | WP_209025522.1 | DUF2513 domain-containing protein | - |
| NW967_RS11270 (NW967_11270) | - | 2290603..2290800 (-) | 198 | WP_209025523.1 | hypothetical protein | - |
| NW967_RS11275 (NW967_11275) | - | 2290841..2291158 (-) | 318 | WP_196429542.1 | hypothetical protein | - |
| NW967_RS11280 (NW967_11280) | - | 2291174..2291383 (-) | 210 | WP_047447803.1 | helix-turn-helix transcriptional regulator | - |
| NW967_RS11285 (NW967_11285) | - | 2291580..2292209 (+) | 630 | WP_258411297.1 | XRE family transcriptional regulator | - |
| NW967_RS11290 (NW967_11290) | - | 2292224..2293114 (+) | 891 | WP_258411298.1 | exonuclease domain-containing protein | - |
| NW967_RS11295 (NW967_11295) | - | 2293252..2293797 (-) | 546 | WP_258411299.1 | hypothetical protein | - |
| NW967_RS11300 (NW967_11300) | - | 2294000..2295205 (+) | 1206 | WP_258411300.1 | site-specific integrase | - |
| NW967_RS11305 (NW967_11305) | - | 2295300..2295899 (-) | 600 | Protein_2180 | transcriptional regulator | - |
| NW967_RS11310 (NW967_11310) | - | 2295925..2297880 (-) | 1956 | WP_000131810.1 | AraC family transcriptional regulator | - |
| NW967_RS11315 (NW967_11315) | - | 2298490..2299299 (+) | 810 | WP_000717388.1 | CHAP domain-containing protein | - |
| NW967_RS11320 (NW967_11320) | - | 2299316..2299558 (-) | 243 | WP_001789136.1 | hypothetical protein | - |
| NW967_RS11325 (NW967_11325) | nhaC | 2299732..2301132 (-) | 1401 | WP_000977732.1 | Na+/H+ antiporter NhaC | - |
| NW967_RS11330 (NW967_11330) | - | 2301227..2302309 (-) | 1083 | WP_000684567.1 | NAD/NADP-dependent octopine/nopaline dehydrogenase family protein | - |
| NW967_RS11335 (NW967_11335) | - | 2302557..2302979 (+) | 423 | WP_000206114.1 | DUF4870 domain-containing protein | - |
| NW967_RS11340 (NW967_11340) | - | 2303216..2303716 (+) | 501 | WP_000737705.1 | CHAP domain-containing protein | - |
| NW967_RS11345 (NW967_11345) | - | 2304078..2305031 (+) | 954 | WP_000417015.1 | 2-hydroxyacid dehydrogenase family protein | - |
| NW967_RS11350 (NW967_11350) | - | 2305111..2306235 (-) | 1125 | WP_000684145.1 | FAD-dependent monooxygenase | - |
| NW967_RS11355 (NW967_11355) | - | 2306546..2307322 (-) | 777 | WP_258411301.1 | N-acetylglucosaminidase | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17653.53 Da Isoelectric Point: 5.9191
>NTDB_id=720230 NW967_RS11215 WP_258411292.1 2283996..2284466(-) (ssbA) [Staphylococcus aureus strain 39-B-49]
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINVIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNTNDSQQDLYQHQAQQTRGQSQYPYNKPVKDNPFANANGPIEIDDNDLPF
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINVIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNTNDSQQDLYQHQAQQTRGQSQYPYNKPVKDNPFANANGPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=720230 NW967_RS11215 WP_258411292.1 2283996..2284466(-) (ssbA) [Staphylococcus aureus strain 39-B-49]
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACGAATGCACAAGGCGAGCGCGAGGCAGATTTTATTAATGTCATTGTAT
TTAAAAAACAAGCAGAGAATGTAAATAAATACCTATCTAAAGGATCATTGGCGGGCGTAGATGGCAGATTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAGGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAGAA
CACAAATGACTCCCAACAAGATTTATACCAACATCAAGCGCAACAAACACGTGGGCAATCTCAATATCCATATAACAAAC
CAGTAAAAGATAATCCGTTCGCAAATGCGAATGGTCCGATTGAAATAGATGACAATGATTTACCGTTCTAA
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACGAATGCACAAGGCGAGCGCGAGGCAGATTTTATTAATGTCATTGTAT
TTAAAAAACAAGCAGAGAATGTAAATAAATACCTATCTAAAGGATCATTGGCGGGCGTAGATGGCAGATTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAGGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAGAA
CACAAATGACTCCCAACAAGATTTATACCAACATCAAGCGCAACAAACACGTGGGCAATCTCAATATCCATATAACAAAC
CAGTAAAAGATAATCCGTTCGCAAATGCGAATGGTCCGATTGAAATAGATGACAATGATTTACCGTTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.367 |
100 |
0.628 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
52.353 |
100 |
0.571 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Vibrio cholerae strain A1552 |
32.065 |
100 |
0.378 |